Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Sem1p

Protein FULL name:

Component of the lid subcomplex of the regulatory subunit of the 26S proteasome; involved in mRNA export mediated by the TREX-2 complex (Sac3p-Thp1p); ortholog of human DSS1


Sem1p (Saccharomyces cerevisiae) is product of expression of SEM1 gene.






FUNCTION: Subunit of the 26S proteasome which plays a role in ubiquitin-dependent proteolysis.

SUBUNIT: Part of the 26S proteasome.

INTERACTION: P38348:HSM3; NbExp=1; IntAct=EBI-31337, EBI-21152; P22141:PRE1; NbExp=1; IntAct=EBI-31337, EBI-13988; P09938:RNR2; NbExp=1; IntAct=EBI-31337, EBI-15240; P33299:RPT1; NbExp=1; IntAct=EBI-31337, EBI-13910;

MISCELLANEOUS: Present with 5590 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the DSS1/SEM1 family.


NCBI GenPept GI number(s): 6320571
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot O94742 O94742
PFAM: - O94742 (Link - using uniprot id)
InterPro: - O94742 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSTDVAAAQAQSKIDLTKKKNEEINKKSLEEDDEFEDFPIDTWANGETIK
SNAVTQTNIWEENWDDVEVDDDFTNELKAELDRYKRENQ

Sem1p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature May 1, 1997
SEM1, a homologue of the split hand/split foot malformation candidate gene Dss1, regulates exocytosis and pseudohyphal differentiation in yeast. Jantti J, Lahdenranta J, Olkkonen VM, Soderlund H, Keranen S Proc Natl Acad Sci U S A Jan. 2, 1999
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Sem1p is a novel subunit of the 26 S proteasome from Saccharomyces cerevisiae. Sone T, Saeki Y, Toh-e A, Yokosawa H J Biol Chem July 2, 2004
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res April 1, 2007


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.