Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rad30p

Protein FULL name:

DNA polymerase eta, involved in tranlesion synthesis during post-replication repair; catalyzes the synthesis of DNA opposite cyclobutane pyrimidine dimers and other lesions; mutations in human pol eta are responsible for XPV


Rad30p (Saccharomyces cerevisiae) is product of expression of RAD30 gene.


Rad30p is involved in:

TLS in Saccharomyces cerevisiae
     


Keywords:



FUNCTION: DNA polymerase specifically involved in DNA repair. Plays an important role in translesion synthesis, where the normal high fidelity DNA polymerases cannot proceed and DNA synthesis stalls. Plays an important role in the repair of UV-induced pyrimidine dimers. Depending on the context, it inserts the correct base, but causes frequent base transitions and transversions. Efficiently incorporates nucleotides opposite to other UV or oxidative DNA damages like O(6)-methylguanine, 7,8- dihydro-8-oxoguanine, 2,6-diamino-4-hydroxy-5-formamidopyrimidine of 2'-deoxyguanosine (FaPydG), or p-benzoquinone DNA adducts.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

SUBUNIT: Interacts with POL30. This interaction is essential for the polymerase eta function.

INTERACTION: P06738:GPH1; NbExp=1; IntAct=EBI-36214, EBI-13389; P48353:HLJ1; NbExp=1; IntAct=EBI-36214, EBI-8369; P53166:MRH4; NbExp=1; IntAct=EBI-36214, EBI-23808; P15873:POL30; NbExp=2; IntAct=EBI-36214, EBI-12993; Q05672:RBS1; NbExp=1; IntAct=EBI-36214, EBI-36115; P38962:TVP23; NbExp=1; IntAct=EBI-36214, EBI-22146;

SUBCELLULAR LOCATION: Nucleus.

INDUCTION: By UV radiation and heat shock. The mRNA is stabilized during stationary phase.

MISCELLANEOUS: Present with 1860 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the DNA polymerase type-Y family.

SIMILARITY: Contains 1 umuC domain.


NCBI GenPept GI number(s): 6320627
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q04049 Q04049
PFAM: - Q04049 (Link - using uniprot id)
InterPro: - Q04049 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSKFTWKELIQLGSPSKAYESSLACIAHIDMNAFFAQVEQMRCGLSKEDP
VVCVQWNSIIAVSYAARKYGISRMDTIQEALKKCSNLIPIHTAVFKKGED
FWQYHDGCGSWVQDPAKQISVEDHKVSLEPYRRESRKALKIFKSACDLVE
RASIDEVFLDLGRICFNMLMFDNEYELTGDLKLKDALSNIREAFIGGNYD
INSHLPLIPEKIKSLKFEGDVFNPEGRDLITDWDDVILALGSQVCKGIRD
SIKDILGYTTSCGLSSTKNVCKLASNYKKPDAQTIVKNDCLLDFLDCGKF
EITSFWTLGGVLGKELIDVLDLPHENSIKHIRETWPDNAGQLKEFLDAKV
KQSDYDRSTSNIDPLKTADLAEKLFKLSRGRYGLPLSSRPVVKSMMSNKN
LRGKSCNSIVDCISWLEVFCAELTSRIQDLEQEYNKIVIPRTVSISLKTK
SYEVYRKSGPVAYKGINFQSHELLKVGIKFVTDLDIKGKNKSYYPLTKLS
MTITNFDIIDLQKTVVDMFGNQVHTFKSSAGKEDEEKTTSSKADEKTPKL
ECCKYQVTFTDQKALQEHADYHLALKLSEGLNGAEESSKNLSFGEKRLLF
SRKRPNSQHTATPQKKQVTSSKNILSFFTRKK

Rad30p (Saccharomyces cerevisiae) is able to recognize following damages:
Rad30p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
The nucleotide sequence of Saccharomyces cerevisiae chromosome IV. Jacq C, Alt-Morbe J, Andre B, Arnold W, Bahr A, Ballesta JP, Bargues M, Baron L, Becker A, Biteau N, Blocker H, Blugeon C, Boskovic J, Brandt P, Bruckner M, Buitrago MJ, Coster F, Delaveau T, del Rey F, Dujon B, Eide LG, Garcia-Cantalejo JM, Goffeau A, Gomez-Peris A, Zaccaria P, et al. Nature May 1, 1997
The Saccharomyces cerevisiae RAD30 gene, a homologue of Escherichia coli dinB and umuC, is DNA damage inducible and functions in a novel error-free postreplication repair mechanism. McDonald JP, Levine AS, Woodgate R Genetics Dec. 1, 1997
Efficient bypass of a thymine-thymine dimer by yeast DNA polymerase, Poleta. Johnson RE, Prakash S, Prakash L Science Jan. 12, 1999
Requirement of DNA polymerase activity of yeast Rad30 protein for its biological function. Johnson RE, Prakash S, Prakash L J Biol Chem June 4, 1999
Fidelity and processivity of Saccharomyces cerevisiae DNA polymerase eta. Washington MT, Johnson RE, Prakash S, Prakash L J Biol Chem Dec. 24, 1999
Specificity of DNA lesion bypass by the yeast DNA polymerase eta. Yuan F, Zhang Y, Rajpal DK, Wu X, Guo D, Wang M, Taylor JS, Wang Z J Biol Chem March 17, 2000
Accuracy of thymine-thymine dimer bypass by Saccharomyces cerevisiae DNA polymerase eta. Washington MT, Johnson RE, Prakash S, Prakash L Proc Natl Acad Sci U S A March 28, 2000
The Saccharomyces cerevisiae RAD6 group is composed of an error-prone and two error-free postreplication repair pathways. Xiao W, Chow BL, Broomfield S, Hanna M Genetics Aug. 1, 2000
Efficient and accurate replication in the presence of 7,8-dihydro-8-oxoguanine by DNA polymerase eta. Haracska L, Yu SL, Johnson RE, Prakash L, Prakash S Nat Genet Aug. 1, 2000
Replication past O(6)-methylguanine by yeast and human DNA polymerase eta. Haracska L, Prakash S, Prakash L Mol Cell Biol Nov. 1, 2000
Requirement of DNA polymerase eta for error-free bypass of UV-induced CC and TC photoproducts. Yu SL, Johnson RE, Prakash S, Prakash L Mol Cell Biol Feb. 1, 2001
Mismatch extension ability of yeast and human DNA polymerase eta. Washington MT, Johnson RE, Prakash S, Prakash L J Biol Chem Feb. 19, 2001
Translesion DNA synthesis by yeast DNA polymerase eta on templates containing N2-guanine adducts of 1,3-butadiene metabolites. Minko IG, Washington MT, Prakash L, Prakash S, Lloyd RS J Biol Chem Feb. 26, 2001
Acidic residues critical for the activity and biological function of yeast DNA polymerase eta. Kondratick CM, Washington MT, Prakash S, Prakash L Mol Cell Biol March 1, 2001
Interaction with PCNA is essential for yeast DNA polymerase eta function. Haracska L, Kondratick CM, Unk I, Prakash S, Prakash L Mol Cell Aug. 1, 2001
Structure of the catalytic core of S. cerevisiae DNA polymerase eta: implications for translesion DNA synthesis. Trincao J, Johnson RE, Escalante CR, Prakash S, Prakash L, Aggarwal AK Mol Cell Aug. 1, 2001
UV-induced T-->C transition at a TT photoproduct site is dependent on Saccharomyces cerevisiae polymerase eta in vivo. Zhang H, Siede W Nucleic Acids Res March 1, 2002
Lesion bypass in yeast cells: Pol eta participates in a multi-DNA polymerase process. Bresson A, Fuchs RP EMBO J July 15, 2002
Deoxynucleotide triphosphate binding mode conserved in Y family DNA polymerases. Johnson RE, Trincao J, Aggarwal AK, Prakash S, Prakash L Mol Cell Biol April 1, 2003
Yeast DNA polymerase eta makes functional contacts with the DNA minor groove only at the incoming nucleoside triphosphate. Washington MT, Wolfle WT, Spratt TE, Prakash L, Prakash S Proc Natl Acad Sci U S A April 1, 2003
Roles of Saccharomyces cerevisiae DNA polymerases Poleta and Polzeta in response to irradiation by simulated sunlight. Kozmin SG, Pavlov YI, Kunkel TA, Sage E Nucleic Acids Res Aug. 1, 2003
Yeast pol eta holds a cis-syn thymine dimer loosely in the active site during elongation opposite the 3'-T of the dimer, but tightly opposite the 5'-T. Sun L, Zhang K, Zhou L, Hohler P, Kool ET, Yuan F, Wang Z, Taylor JS Biochemistry Aug. 12, 2003
Mechanism of nucleotide incorporation opposite a thymine-thymine dimer by yeast DNA polymerase eta. Washington MT, Prakash L, Prakash S Proc Natl Acad Sci U S A Oct. 14, 2003
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature Oct. 16, 2003
Role of DNA polymerase eta in the bypass of abasic sites in yeast cells. Zhao B, Xie Z, Shen H, Wang Z Nucleic Acids Res Jan. 1, 2004
Enzymatic switching for efficient and accurate translesion DNA replication. McCulloch SD, Kokoska RJ, Chilkova O, Welch CM, Johansson E, Burgers PM, Kunkel TA Nucleic Acids Res Jan. 1, 2004
Palm mutants in DNA polymerases alpha and eta alter DNA replication fidelity and translesion activity. Niimi A, Limsirichaikul S, Yoshida S, Iwai S, Masutani C, Hanaoka F, Kool ET, Nishiyama Y, Suzuki M Mol Cell Biol April 1, 2004
LC-MS/MS identification and yeast polymerase eta bypass of a novel gamma-irradiation-induced intrastrand cross-link lesion G[8-5]C. Gu C, Wang Y Biochemistry June 1, 2004
Role of base stacking and sequence context in the inhibition of yeast DNA polymerase eta by pyrene nucleotide. Hwang H, Taylor JS Biochemistry Nov. 23, 2004
The relative roles in vivo of Saccharomyces cerevisiae Pol eta, Pol zeta, Rev1 protein and Pol32 in the bypass and mutation induction of an abasic site, T-T (6-4) photoadduct and T-T cis-syn cyclobutane dimer. Gibbs PE, McDonald J, Woodgate R, Lawrence CW Genetics Jan. 1, 2005
Evidence for Watson-Crick and not Hoogsteen or wobble base pairing in the selection of nucleotides for insertion opposite pyrimidines and a thymine dimer by yeast DNA pol eta. Hwang H, Taylor JS Biochemistry March 1, 2005
Mechanism of efficient and accurate nucleotide incorporation opposite 7,8-dihydro-8-oxoguanine by Saccharomyces cerevisiae DNA polymerase eta. Carlson KD, Washington MT Mol Cell Biol March 1, 2005
Transcript copy number of genes for DNA repair and translesion synthesis in yeast: contribution of transcription rate and mRNA stability to the steady-state level of each mRNA along with growth in glucose-fermentative medium. Michan C, Monje-Casas F, Pueyo C DNA Repair (Amst) April 4, 2005
The p-benzoquinone DNA adducts derived from benzene are highly mutagenic. Xie Z, Zhang Y, Guliaev AB, Shen H, Hang B, Singer B, Wang Z DNA Repair (Amst) Dec. 8, 2005
Base pairing and replicative processing of the formamidopyrimidine-dG DNA lesion. Ober M, Muller H, Pieck C, Gierlich J, Carell T J Am Chem Soc Dec. 28, 2005
Poleta, Polzeta and Rev1 together are required for G to T transversion mutations induced by the (+)- and (-)-trans-anti-BPDE-N2-dG DNA adducts in yeast cells. Zhao B, Wang J, Geacintov NE, Wang Z Nucleic Acids Res Jan. 1, 2006
The in vivo characterization of translesion synthesis across UV-induced lesions in Saccharomyces cerevisiae: insights into Pol zeta- and Pol eta-dependent frameshift mutagenesis. Abdulovic AL, Jinks-Robertson S Genetics March 1, 2006
DNA synthesis past a 5-methylC-containing cis-syn-cyclobutane pyrimidine dimer by yeast pol eta is highly nonmutagenic. Vu B, Cannistraro VJ, Sun L, Taylor JS Biochemistry Aug. 1, 2006


Last modification of this entry: Oct. 15, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.