Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Hnt3p

Protein FULL name:

DNA 5' AMP hydrolase involved in DNA repair; member of the histidine triad (HIT) superfamily of nucleotide-binding proteins; homolog of Aprataxin, a Hint related protein that is mutated in individuals with ataxia with oculomotor apraxia


Hnt3p (Saccharomyces cerevisiae) is product of expression of HNT3 gene.


Hnt3p is involved in:

BER in Saccharomyces cerevisiae
     


Keywords:



FUNCTION: DNA-binding protein involved in single-strand DNA break repair, double-strand DNA break repair and base excision repair. Resolves abortive DNA ligation intermediates formed either at base excision sites, or when DNA ligases attempt to repair non- ligatable breaks induced by reactive oxygen species. Catalyzes the release of adenylate groups covalently linked to 5'-phosphate termini, resulting in the production of 5'-phosphate termini that can be efficiently rejoined.

INTERACTION: P53969:SAM50; NbExp=1; IntAct=EBI-30129, EBI-28646;

SUBCELLULAR LOCATION: Nucleus. Cytoplasm.

DOMAIN: The HIT domain is required for enzymatic activity (By similarity).

MISCELLANEOUS: Present with 396 molecules/cell in log phase SD medium.

SIMILARITY: Contains 1 HIT domain.


NCBI GenPept GI number(s): 6324832
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot Q08702 Q08702
PFAM: - Q08702 (Link - using uniprot id)
InterPro: - Q08702 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSWRYALKNYVTSPETVNDDTVTYFDDKVSIIRDSFPKSECHLLILPRTM
QLSRSHPTKVIDAKFKNEFESYVNSAIDHIFRHFQEKFRIKKSDDDKDPC
WDDILKDKNKFVRNFVQVGIHSVPSMANLHIHVISKDFHSVRLKNKKHYN
SFNTGFFISWDDLPLNGKNLGTDKEIETTYLKEHDLLCCYCQRNFSNKFS
LLKKHLELEFNSHFELK

Hnt3p (Saccharomyces cerevisiae) is able to recognize following damages:
Hnt3p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Yeast gene required for spindle pole body duplication: homology of its product with Ca2+-binding proteins. Baum P, Furlong C, Byers B Proc Natl Acad Sci U S A Aug. 1, 1986
Sequencing analysis of a 36.8 kb fragment of yeast chromosome XV reveals 26 open reading frames including SEC63, CDC31, SUG2, GCD1, RBL2, PNT1, PAC1 and VPH1. Poirey R, Jauniaux JC Yeast April 1, 1997
The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. Nature May 1, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Global analysis of protein localization in budding yeast. Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK Nature Oct. 16, 2003
Aprataxin forms a discrete branch in the HIT (histidine triad) superfamily of proteins with both DNA/RNA binding and nucleotide hydrolase activities. Kijas AW, Harris JL, Harris JM, Lavin MF J Biol Chem May 19, 2006
The neurodegenerative disease protein aprataxin resolves abortive DNA ligation intermediates. Ahel I, Rass U, El-Khamisy SF, Katyal S, Clements PM, McKinnon PJ, Caldecott KW, West SC Nature Oct. 12, 2006


Last modification of this entry: Oct. 12, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.