Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Hnt3p |
Protein FULL name:
DNA 5' AMP hydrolase involved in DNA repair; member of the histidine triad (HIT) superfamily of nucleotide-binding proteins; homolog of Aprataxin, a Hint related protein that is mutated in individuals with ataxia with oculomotor apraxia
Hnt3p (Saccharomyces cerevisiae) is product of expression of HNT3 gene.
Hnt3p is involved in:
BER in Saccharomyces cerevisiae
Keywords:
- double-strand break (DSB)
- single strand break (SSB)
- base excision repair (BER)
- long path BER (LP-BER)
FUNCTION: DNA-binding protein involved in single-strand DNA break repair, double-strand DNA break repair and base excision repair. Resolves abortive DNA ligation intermediates formed either at base excision sites, or when DNA ligases attempt to repair non- ligatable breaks induced by reactive oxygen species. Catalyzes the release of adenylate groups covalently linked to 5'-phosphate termini, resulting in the production of 5'-phosphate termini that can be efficiently rejoined.
INTERACTION: P53969:SAM50; NbExp=1; IntAct=EBI-30129, EBI-28646;
SUBCELLULAR LOCATION: Nucleus. Cytoplasm.
DOMAIN: The HIT domain is required for enzymatic activity (By similarity).
MISCELLANEOUS: Present with 396 molecules/cell in log phase SD medium.
SIMILARITY: Contains 1 HIT domain.
| NCBI GenPept GI number(s): |
6324832 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q08702 |
Q08702 |
| PFAM: | - |
Q08702 (Link - using uniprot id) |
| InterPro: | - |
Q08702 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSWRYALKNYVTSPETVNDDTVTYFDDKVSIIRDSFPKSECHLLILPRTM QLSRSHPTKVIDAKFKNEFESYVNSAIDHIFRHFQEKFRIKKSDDDKDPC WDDILKDKNKFVRNFVQVGIHSVPSMANLHIHVISKDFHSVRLKNKKHYN SFNTGFFISWDDLPLNGKNLGTDKEIETTYLKEHDLLCCYCQRNFSNKFS LLKKHLELEFNSHFELK |
Hnt3p (Saccharomyces cerevisiae) is able to recognize following damages:
Hnt3p (Saccharomyces cerevisiae) belongs to following protein families:
References:
| Title | Authors | Journal |
| Yeast gene required for spindle pole body duplication: homology of its product with Ca2+-binding proteins. | Baum P, Furlong C, Byers B | Proc Natl Acad Sci U S A Aug. 1, 1986 |
| Sequencing analysis of a 36.8 kb fragment of yeast chromosome XV reveals 26 open reading frames including SEC63, CDC31, SUG2, GCD1, RBL2, PNT1, PAC1 and VPH1. | Poirey R, Jauniaux JC | Yeast April 1, 1997 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. | Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. | Nature May 1, 1997 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Global analysis of protein localization in budding yeast. | Huh WK, Falvo JV, Gerke LC, Carroll AS, Howson RW, Weissman JS, O'Shea EK | Nature Oct. 16, 2003 |
| Aprataxin forms a discrete branch in the HIT (histidine triad) superfamily of proteins with both DNA/RNA binding and nucleotide hydrolase activities. | Kijas AW, Harris JL, Harris JM, Lavin MF | J Biol Chem May 19, 2006 |
| The neurodegenerative disease protein aprataxin resolves abortive DNA ligation intermediates. | Ahel I, Rass U, El-Khamisy SF, Katyal S, Clements PM, McKinnon PJ, Caldecott KW, West SC | Nature Oct. 12, 2006 |
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|