REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

Mlh3p

Mlh3p (Saccharomyces cerevisiae) is product of expression of MLH3 gene.

Keywords:

mismatch repair (MMR)

FUNCTION: Involved in DNA mismatch repair (MMR), correcting insertion-deletion loops (IDLs) resulting from DNA replication, DNA damage or from recombination events between non-identical sequences during meiosis. Component of the MutLbeta heterodimer, which probably forms a ternary complex with the MutSbeta heterodimer that initially recognizes the DNA mismatches. This complex is thought to be responsible for directing the downsteam MMR events, including strand discrimination, excision, and resynthesis. Plays a major role in promoting meiotic crossing-over and is involved in maintaining the genetic stability of simple sequence repeats by corection of frameshift intermediates.

SUBUNIT: Heterodimer of MLH1 and MLH3, called MutLbeta, which is involved in correction of a specific subset of IDLs when associated with MutSbeta. Forms a ternary complex with a SGS1-TOP3 heterodimer during meiosis.

INTERACTION: P38920:MLH1; NbExp=3; IntAct=EBI-31634, EBI-11003; P07257:QCR2; NbExp=1; IntAct=EBI-31634, EBI-19929; P35187:SGS1; NbExp=1; IntAct=EBI-31634, EBI-17059;

SUBCELLULAR LOCATION: Nucleus (Probable).

SIMILARITY: Belongs to the DNA mismatch repair mutL/hexB family.

NCBI GenPept GI number(s):	6325093
Species:	Saccharomyces cerevisiae

Links to other databases:

Database	ID	Link
Uniprot	Q12083	Q12083
PFAM:	-	Q12083 (Link - using uniprot id)
InterPro:	-	Q12083 (Link - using uniprot id)
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MSQHIRKLDSDVSERLKSQACTVSLASAVREIVQNSVDAHATTIDVMIDL
PNLSFAVYDDGIGLTRSDLNILATQNYTSKIRKMNDLVTMKTYGYRGDAL
YSISNVSNLFVCSKKKDYNSAWMRKFPSKSVMLSENTILPIDPFWKICPW
SRTKSGTVVIVEDMLYNLPVRRRILKEEPPFKTFNTIKADMLQILVMHPM
ISLNVQYTDKLRINTEVLFRSKNITEGLTKHQQMSQVLRNVFGAIIPPDM
LKKVSLKFNEYQIEGIISKMPVGLKDLQFIYINGRRYADSAFQGYVDSLF
QAQDFGEKGMSLLKTKSVGKPYRSHPVFILDVRCPQTIDDLLQDPAKKIV
KPSHIRTIEPLIVKTIRSFLTFQGYLTPDKSDSSFEIVNCSQKTATLPDS
RIQISKRNQVLNSKMKIARINSYIGKPAVNGCRINNSTINYEKIKNIRID
GQKSRLRNKLSSRPYDSGFTEDYDSIGKTITDFSISRSVLAKYEVINQVD
KKFILIRCLDQSIHNCPLLVLVDQHACDERIRLEELFYSLLTEVVTGTFV
ARDLKDCCIEVDRTEADLFKHYQSEFKKWGIGYETIEGTMETSLLEIKTL
PEMLTSKYNGDKDYLKMVLLQHAHDLKDFKKLPMDLSHFENYTSVDKLYW
WKYSSCVPTVFHEILNSKACRSAVMFGDELTRQECIILISKLSRCHNPFE
CAHGRPSMVPIAELK

Mlh3p (Saccharomyces cerevisiae) belongs to following protein families:

fam50v00000017174

References:

Title	Authors	Journal
The sequence of 55 kb on the left arm of yeast chromosome XVI identifies a small nuclear RNA, a new putative protein kinase and two new putative regulators.	Purnelle B, Coster F, Goffeau A	Yeast Nov. 1, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XVI.	Bussey H, Storms RK, Ahmed A, Albermann K, Allen E, Ansorge W, Araujo R, Aparicio A, Barrell B, Badcock K, Benes V, Botstein D, Bowman S, Bruckner M, Carpenter J, Cherry JM, Chung E, Churcher C, Coster F, Davis K, Davis RW, Dietrich FS, Delius H, DiPaolo T, Hani J, et al.	Nature May 1, 1997
The Saccharomyces cerevisiae MLH3 gene functions in MSH3-dependent suppression of frameshift mutations.	Flores-Rozas H, Kolodner RD	Proc Natl Acad Sci U S A Oct. 13, 1998
Functional specificity of MutL homologs in yeast: evidence for three Mlh1-based heterocomplexes with distinct roles during meiosis in recombination and mismatch correction.	Wang TF, Kleckner N, Hunter N	Proc Natl Acad Sci U S A Nov. 23, 1999
Discrete in vivo roles for the MutL homologs Mlh2p and Mlh3p in the removal of frameshift intermediates in budding yeast.	Harfe BD, Minesinger BK, Jinks-Robertson S	Curr Biol Jan. 10, 2000
Supercomplex formation between Mlh1-Mlh3 and Sgs1-Top3 heterocomplexes in meiotic yeast cells.	Wang TF, Kung WM	Biochem Biophys Res Commun Aug. 1, 2002

Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.