Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Ogg1p

Protein FULL name:

Mitochondrial glycosylase/lyase that specifically excises 7,8-dihydro-8-oxoguanine residues located opposite cytosine or thymine residues in DNA, repairs oxidative damage to mitochondrial DNA, contributes to UVA resistance


Ogg1p (Saccharomyces cerevisiae) is product of expression of OGG1 gene.


Ogg1p is involved in:

BER in Saccharomyces cerevisiae

Keywords:



FUNCTION: DNA repair enzyme that incises DNA at 8-oxoG residues. Excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N- methylformamidopyrimidine (FAPY) from damaged DNA. Has a beta- lyase activity that nicks DNA 3' to the lesion.

CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 3690 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the type-1 OGG1 family.


NCBI GenPept GI number(s): 6323580
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P53397 P53397
PFAM: - P53397 (Link - using uniprot id)
InterPro: - P53397 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSYKFGKLAINKSELCLANVLQAGQSFRWIWDEKLNQYSTTMKIGQQEKY
SVVILRQDEENEILEFVAVGDCGNQDALKTHLMKYFRLDVSLKHLFDNVW
IPSDKAFAKLSPQGIRILAQEPWETLISFICSSNNNISRITRMCNSLCSN
FGNLITTIDGVAYHSFPTSEELTSRATEAKLRELGFGYRAKYIIETARKL
VNDKAEANITSDTTYLQSICKDAQYEDVREHLMSYNGVGPKVADCVCLMG
LHMDGIVPVDVHVSRIAKRDYQISANKNHLKELRTKYNALPISRKKINLE
LDHIRLMLFKKWGSYAGWAQGVLFSKEIGGTSGSTTTGTIKKRKWDMIKE
TEAIVTKQMKLKVELSDLHIKEAKID

Ogg1p (Saccharomyces cerevisiae) is able to recognize following damages:
Ogg1p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Cloning and expression in Escherichia coli of the OGG1 gene of Saccharomyces cerevisiae, which codes for a DNA glycosylase that excises 7,8-dihydro-8-oxoguanine and 2,6-diamino-4-hydroxy-5-N-methylformamidopyrimidine. van der Kemp PA, Thomas D, Barbey R, de Oliveira R, Boiteux S Proc Natl Acad Sci U S A May 28, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome XIII. Bowman S, Churcher C, Badcock K, Brown D, Chillingworth T, Connor R, Dedman K, Devlin K, Gentles S, Hamlin N, Hunt S, Jagels K, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Skelton J, Walsh S, Whitehead S, Barrell B Nature May 1, 1997
The Ogg1 protein of Saccharomyces cerevisiae: a 7,8-dihydro-8-oxoguanine DNA glycosylase/AP lyase whose lysine 241 is a critical residue for catalytic activity. Girard PM, Guibourt N, Boiteux S Nucleic Acids Res Aug. 15, 1997
Catalytic and DNA binding properties of the ogg1 protein of Saccharomyces cerevisiae: comparison between the wild type and the K241R and K241Q active-site mutant proteins. Guibourt N, Castaing B, Van Der Kemp PA, Boiteux S Biochemistry Jan. 22, 2000
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003


Last modification of this entry: Oct. 14, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.