Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Tdp1p

Tdp1p (Saccharomyces cerevisiae) is product of expression of TDP1 gene.






FUNCTION: DNA repair enzyme that can remove a variety of covalent adducts from DNA through hydrolysis of a 3'-phosphodiester bond, giving rise to DNA with a free 3' phosphate. Catalyzes the hydrolysis of dead-end complexes between DNA and the topoisomerase I active site tyrosine residue. Hydrolyzes 3'-phosphoglycolates on protruding 3' ends on DNA double-strand breaks due to DNA damage by radiation and free radicals. Cleaves also 5' phosphotyrosyl adducts resulting from dead-end complexes between DNA and the active site tyrosine of topoisomerase II. Contributes to DNA repair after radiation damage. Acts on blunt-ended double-strand DNA breaks and on single-stranded DNA. May have low 3'exonuclease activity and may be able to remove a single nucleoside from the 3'end of DNA and RNA molecules with 3'hydroxyl groups. Has no exonuclease activity towards DNA or RNA with a 3'phosphate (By similarity).

INTERACTION: Q12306:SMT3; NbExp=1; IntAct=EBI-20997, EBI-17490; P23255:TAF2; NbExp=1; IntAct=EBI-20997, EBI-18862;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 2130 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the tyrosyl-DNA phosphodiesterase family.


NCBI GenPept GI number(s): 6319701
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P38319 P38319
PFAM: - P38319 (Link - using uniprot id)
InterPro: - P38319 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSRETNFNGTKRKRSDVAEKVAQRWKSVRYSAEMENMAPVNSNNDSDDCV
IVSESKIIDLTNQEQDLSERIETNDTAKGAVFKLMKSDFYEREDFMGEVE
DMITLKDIFGTETLKRSILFSFQYELDFLLRQFHQNVENITIVGQKGTIM
PIEARAMDATLAVILKKVKLIEITMPPFASHHTKLIINFYDNGECKIFLP
SNNFTSMETNLPQQVCWCSPLLKIGKEGLPVPFKRSLIEYLNSYHLKDID
ELITKSVEEVNFAPLSELEFVYSTPSKFQSSGLLSFYNKLEKLSAGTSAS
DTAKHYLCQTSSIGTSLSRARDENLWTHLMIPLFTGIMSPPAKDTAGRKK
AEILPTNSLINEYSQRKIKPYIIFPTEQEFVTSPLKWSSSGWFHFQYLQK
KSYYEMLRNKFKVFYKQDPAMVTRRRGTTPAHSKFYMHCATNSAGPCDAS
QVFKELEWCLYTSANLSQTAWGTVSRKPRNYEAGVLYHSRRLANTRKVTC
RTFTRDRRGCAGNPTHVAVPFTLPVIPYDLAEDECFCLARHEND

Tdp1p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Complete DNA sequence of yeast chromosome II. Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, et al. EMBO J Dec. 15, 1994
Yeast gene for a Tyr-DNA phosphodiesterase that repairs topoisomerase I complexes. Pouliot JJ, Yao KC, Robertson CA, Nash HA Science Oct. 15, 1999
Genome-wide nuclear morphology screen identifies novel genes involved in nuclear architecture and gene-silencing in Saccharomyces cerevisiae. Teixeira MT, Dujon B, Fabre E J Mol Biol Aug. 23, 2002
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Tyrosyl-DNA phosphodiesterase (Tdp1) participates in the repair of Top2-mediated DNA damage. Nitiss KC, Malik M, He X, White SW, Nitiss JL Proc Natl Acad Sci U S A June 13, 2006
Mutation of a conserved active site residue converts tyrosyl-DNA phosphodiesterase I into a DNA topoisomerase I-dependent poison. He X, van Waardenburg RC, Babaoglu K, Price AC, Nitiss KC, Nitiss JL, Bjornsti MA, White SW J Mol Biol Sept. 28, 2007


Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.