Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Met18p

Protein FULL name:

DNA repair and TFIIH regulator, required for both nucleotide excision repair (NER) and RNA polymerase II (RNAP II) transcription; involved in telomere maintenance


Met18p (Saccharomyces cerevisiae) is product of expression of MET18 gene.


Met18p is involved in:

NER in Saccharomyces cerevisiae
     


Keywords:



FUNCTION: Involved in nucleotide excision repair (NER) and RNA polymerase II (POL II) transcription. Required for both transcription-coupled and global NER. It probably does not participate directly in NER and POL II transcription, but exerts its biological effects by influencing the activity of TFIIH and possibly other DNA repair and transcription factors as an upstream regulatory element. Involved in sporulation and possibly in the RAD52 recombinational repair pathway.

INTERACTION: P38829:-; NbExp=1; IntAct=EBI-11492, EBI-24704; Q99278:MED11; NbExp=2; IntAct=EBI-11492, EBI-27213;

SUBCELLULAR LOCATION: Nucleus (By similarity).

MISCELLANEOUS: Present with 3150 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the MET18/MMS19 family.

SIMILARITY: Contains 13 HEAT repeats.


NCBI GenPept GI number(s): 6322063
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P40469 P40469
PFAM: - P40469 (Link - using uniprot id)
InterPro: - P40469 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MTPDELNSAVVTFMANLNIDDSKANETASTVTDSIVHRSIKLLEVVVALK
DYFLSENEVERKKALTCLTTILAKTPKDHLSKNECSVIFQFYQSKLDDQA
LAKEVLEGFAALAPMKYVSINEIAQLLRLLLDNYQQGQHLASTRLWPFKI
LRKIFDRFFVNGSSTEQVKRINDLFIETFLHVANGEKDPRNLLLSFALNK
SITSSLQNVENFKEDLFDVLFCYFPITFKPPKHDPYKISNQDLKTALRSA
ITATPLFAEDAYSNLLDKLTASSPVVKNDTLLTLLECVRKFGGSSILENW
TLLWNALKFEIMQNSEGNENTLLNPYNKDQQSDDVGQYTNYDACLKIINL
MALQLYNFDKVSFEKFFTHVLDELKPNFKYEKDLKQTCQILSAIGSGNVE
IFNKVISSTFPLFLINTSEVAKLKLLIMNFSFFVDSYIDLFGRTSKESLG
TPVPNNKMAEYKDEIIMILSMALTRSSKAEVTIRTLSVIQFTKMIKMKGF
LTPEEVSLIIQYFTEEILTDNNKNIYYACLEGLKTISEIYEDLVFEISLK
KLLDLLPDCFEEKIRVNDEENIHIETILKIILDFTTSRHILVKESITFLA
TKLNRVAKISKSREYCFLLISTIYSLFNNNNQNENVLNEEDALALKNAIE
PKLFEIITQESAIVSDNYNLTLLSNVLFFTNLKIPQAAHQEELDRYNELF
ISEGKIRILDTPNVLAISYAKILSALNKNCQFPQKFTVLFGTVQLLKKHA
PRMTETEKLGYLELLLVLSNKFVSEKDVIGLFDWKDLSVINLEVMVWLTK
GLIMQNSLESSEIAKKFIDLLSNEEIGSLVSKLFEVFVMDISSLKKFKGI
SWNNNVKILYKQKFFGDIFQTLVSNYKNTVDMTIKCNYLTALSLVLKHTP
SQSVGPFINDLFPLLLQALDMPDPEVRVSALETLKDTTDKHHTLITEHVS
TIVPLLLSLSLPHKYNSVSVRLIALQLLEMITTVVPLNYCLSYQDDVLSA
LIPVLSDKKRIIRKQCVDTRQVYYELGQIPFE

Met18p (Saccharomyces cerevisiae) belongs to following protein families:
References:

Title Authors Journal
Three additional genes involved in pyrimidine dimer removal in Saccharomyces cerevisiae: RAD7, RAD14 and MMS19. Prakash L, Prakash S Mol Gen Genet Nov. 1, 1979
Dual requirement for the yeast MMS19 gene in DNA repair and RNA polymerase II transcription. Lauder S, Bankmann M, Guzder SN, Sung P, Prakash L, Prakash S Mol Cell Biol Dec. 1, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome IX. Churcher C, Bowman S, Badcock K, Bankier A, Brown D, Chillingworth T, Connor R, Devlin K, Gentles S, Hamlin N, Harris D, Horsnell T, Hunt S, Jagels K, Jones M, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Rowley N, Skelton J, Smith V, Barrell B, et al. Nature May 1, 1997
Saccharomyces cerevisiae mms19 mutants are deficient in transcription-coupled and global nucleotide excision repair. Lombaerts M, Tijsterman M, Verhage RA, Brouwer J Nucleic Acids Res Oct. 15, 1997
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Quantitative trait loci mapped to single-nucleotide resolution in yeast. Deutschbauer AM, Davis RW Nat Genet Dec. 1, 2005


Last modification of this entry: Oct. 19, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.