Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
UmuD |
Protein FULL name:
UmuD [Escherichia coli].
UmuD (Escherichia coli strain K-12 substr. MG1655) is product of expression of umuD gene.
UmuD is involved in:
TLS in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Involved in UV protection and mutation. Essential for induced (or SOS) mutagenesis. May modify the DNA replication machinery to allow bypass synthesis across a damaged template.
SIMILARITY: Belongs to the peptidase S24 family.
| NCBI GenPept GI number(s): |
85376582 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0AG11 |
P0AG11 |
| PFAM: | - |
P0AG11 (Link - using uniprot id) |
| InterPro: | - |
P0AG11 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MLFIKPADLREIVTFPLFSDLVQCGFPSPAADYVEQRIDLNQLLIQHPSA TYFVKASGDSMIDGGISDGDLLIVDSAITASHGDIVIAAVDGEFTVKKLQ LRPTVQLTPMNSAYSPITISSEDTLDVFGVVIHVVKAMR |
UmuD (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
UmuD (Escherichia coli strain K-12 substr. MG1655) belongs to following protein families:
References:
| Title | Authors | Journal |
| Structural analysis of the umu operon required for inducible mutagenesis in Escherichia coli. | Kitagawa Y, Akaboshi E, Shinagawa H, Horii T, Ogawa H, Kato T | Proc Natl Acad Sci U S A July 1, 1985 |
| umuDC and mucAB operons whose products are required for UV light- and chemical-induced mutagenesis: UmuD, MucA, and LexA proteins share homology. | Perry KL, Elledge SJ, Mitchell BB, Marsh L, Walker GC | Proc Natl Acad Sci U S A July 1, 1985 |
| Escherichia coli umuDC mutants: DNA sequence alterations and UmuD cleavage. | Koch WH, Ennis DG, Levine AS, Woodgate R | Mol Gen Genet June 1, 1992 |
| Structure of the UmuD' protein and its regulation in response to DNA damage. | Peat TS, Frank EG, McDonald JP, Levine AS, Woodgate R, Hendrickson WA | Nature April 25, 1996 |
| A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. | Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. | DNA Res June 1, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|