REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

HolC

Protein FULL name:

DNA polymerase III chi subunit [Escherichia coli].

HolC (Escherichia coli strain K-12 substr. MG1655) is product of expression of holC gene.

HolC is involved in:

MMR in Escherichia coli strain K-12 substr. MG1655

Keywords:

mismatch repair (MMR)

FUNCTION: DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

SUBUNIT: The DNA polymerase holoenzyme is a complex that contains 10 different types of subunits. These subunits are organized into 3 functionally essential subassemblies: the pol III core, the beta sliding clamp processivity factor and the clamp-loading complex. The pol III core (subunits alpha,epsilon and theta) contains the polymerase and the 3'-5' exonuclease proofreading activities. The polymerase is tethered to the template via the sliding clamp processivity factor. The clamp-loading complex assembles the beta processivity factor onto the primer template and plays a central role in the organization and communication at the replication fork. This complex contains delta, delta', psi and chi, and copies of either or both of two different dnaX proteins, gamma and tau. The composition of the holoenzyme is, therefore: (alpha,epsilon,theta)[2]-(gamma/tau)[3]-delta,delta', psi,chi- beta[4].

This protein can be a part of a given complexes:

DNA polymerase III

NCBI GenPept GI number(s):	145537
Species:	Escherichia coli

Links to other databases:

Database	ID	Link
Uniprot	P28905	P28905
PFAM:	-	P28905 (Link - using uniprot id)
InterPro:	-	P28905 (Link - using uniprot id)
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MKNATFYLLDNDTTVDGLSAVEQLVCEIAAERWRSGKRVLIACEDEKQAY
RLDEALWARPAESFVPHNLAGEGPRGGAPVEIAWPQKRSSSRRDILISLR
TSFADFATAFTEVVDFVPYEDSLKQLARERYKAYRVAGFNLNTATWK

References:

Title	Authors	Journal
xerB, an Escherichia coli gene required for plasmid ColE1 site-specific recombination, is identical to pepA, encoding aminopeptidase A, a protein with substantial similarity to bovine lens leucine aminopeptidase.	Stirling CJ, Colloms SD, Collins JF, Szatmari G, Sherratt DJ	EMBO J May 1, 1989
Accessory protein function in the DNA polymerase III holoenzyme from E. coli.	O'Donnell M	Bioessays Jan. 1, 1992
DNA polymerase III accessory proteins. III. holC and holD encoding chi and psi.	Xiao H, Crombie R, Dong Z, Onrust R, O'Donnell M	J Biol Chem June 5, 1993
DNA polymerase III accessory proteins. IV. Characterization of chi and psi.	Xiao H, Dong Z, O'Donnell M	J Biol Chem June 5, 1993
Identification, molecular cloning and characterization of the gene encoding the chi subunit of DNA polymerase III holoenzyme of Escherichia coli.	Carter JR, Franden MA, Lippincott JA, McHenry CS	Mol Gen Genet Nov. 1, 1993
Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes.	Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL, Blattner FR	Nucleic Acids Res June 25, 1995
The complete genome sequence of Escherichia coli K-12.	Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y	Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.	Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T	Mol Syst Biol Jan. 1, 2006

Last modification of this entry: Oct. 12, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.