Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
HolB |
Protein FULL name:
DNA polymerase III delta prime subunit [Escherichia coli].
HolB (Escherichia coli strain K-12 substr. MG1655) is product of expression of holB gene.
HolB is involved in:
MMR in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
SUBUNIT: The DNA polymerase holoenzyme is a complex that contains 10 different types of subunits. These subunits are organized into 3 functionally essential subassemblies: the pol III core, the beta sliding clamp processivity factor and the clamp-loading complex. The pol III core (subunits alpha,epsilon and theta) contains the polymerase and the 3'-5' exonuclease proofreading activities. The polymerase is tethered to the template via the sliding clamp processivity factor. The clamp-loading complex assembles the beta processivity factor onto the primer template and plays a central role in the organization and communication at the replication fork. This complex contains delta, delta', psi and chi, and copies of either or both of two different dnaX proteins, gamma and tau. The composition of the holoenzyme is, therefore: (alpha,epsilon,theta)[2]-(gamma/tau)[3]-delta,delta', psi,chi- beta[4].
INTERACTION: P23367:mutL; NbExp=2; IntAct=EBI-549161, EBI-554913;
This protein can be a part of a given complexes:
| NCBI GenPept GI number(s): |
145799 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P28631 |
P28631 |
| PFAM: | - |
P28631 (Link - using uniprot id) |
| InterPro: | - |
P28631 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MRWYPWLRPDFEKLVASYQAGRGHHALLIQALPGMGDDALIYALSRYLLC QQPQGHKSCGHCRGCQLMQAGTHPDYYTLAPEKGKNTLGVDAVREVTEKL NEHARLGGAKVVWVTDAALLTDAAANALLKTLEEPPAETWFFLATREPER LLATLRSRCRLHYLAGPPEQYAVTWLSREVTMSQDALLAALRLSAGSPGA ALALFQGDNWQARETLCQALAYSVPSGDWYSLLAALNHEQAPARLHWLAT LLMDALKRHHGAAQVTNVDVPGLVAELANHLSPSRLQAILGDVCHIREQL MSVTGINRELLITDLLLRIEHYLQPGVVLPVPHL |
References:
| Title | Authors | Journal |
| Accessory protein function in the DNA polymerase III holoenzyme from E. coli. | O'Donnell M | Bioessays Jan. 1, 1992 |
| Identification, isolation, and characterization of the structural gene encoding the delta' subunit of Escherichia coli DNA polymerase III holoenzyme. | Carter JR, Franden MA, Aebersold R, McHenry CS | J Bacteriol June 1, 1993 |
| DNA polymerase III accessory proteins. I. holA and holB encoding delta and delta'. | Dong Z, Onrust R, Skangalis M, O'Donnell M | J Biol Chem June 5, 1993 |
| DNA polymerase III accessory proteins. II. Characterization of delta and delta'. | Onrust R, O'Donnell M | J Biol Chem June 5, 1993 |
| A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. | Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. | DNA Res June 1, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Crystal structure of the delta' subunit of the clamp-loader complex of E. coli DNA polymerase III. | Guenther B, Onrust R, Sali A, O'Donnell M, Kuriyan J | Cell Oct. 31, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|