REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

HolA

Protein FULL name:

DNA polymerase III delta subunit [Escherichia coli].


HolA (Escherichia coli strain K-12 substr. MG1655) is product of expression of holA gene.


HolA is involved in:

MMR in Escherichia coli strain K-12 substr. MG1655

Keywords:



FUNCTION: DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity. The delta subunit seems to interact with the gamma subunit to transfer the beta subunit on the DNA.

CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).

SUBUNIT: The DNA polymerase holoenzyme is a complex that contains 10 different types of subunits. These subunits are organized into 3 functionally essential subassemblies: the pol III core, the beta sliding clamp processivity factor and the clamp-loading complex. The pol III core (subunits alpha,epsilon and theta) contains the polymerase and the 3'-5' exonuclease proofreading activities. The polymerase is tethered to the template via the sliding clamp processivity factor. The clamp-loading complex assembles the beta processivity factor onto the primer template and plays a central role in the organization and communication at the replication fork. This complex contains delta, delta', psi and chi, and copies of either or both of two different dnaX proteins, gamma and tau. The composition of the holoenzyme is, therefore: (alpha,epsilon,theta)[2]-(gamma/tau)[3]-delta,delta', psi,chi- beta[4].

INTERACTION: P0A988:dnaN; NbExp=2; IntAct=EBI-549153, EBI-542385; P0A6F5:groL; NbExp=1; IntAct=EBI-549153, EBI-543750; P23367:mutL; NbExp=2; IntAct=EBI-549153, EBI-554913;


This protein can be a part of a given complexes:
NCBI GenPept GI number(s): 145729
Species: Escherichia coli

Links to other databases:

Database ID Link
Uniprot P28630 P28630
PFAM: - P28630 (Link - using uniprot id)
InterPro: - P28630 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MIRLYPEQLRAQLNEGLRAAYLLLGNDPLLLQESQDAVRQVAAAQGFEEH
HTFSIDPNTDWNAIFSLCQAMSLFASRQTLLLLLPENGPNAAINEQLLTL
TGLLHDDLLLIVRGNKLSKAQENAAWFTALANRSVQVTCQTPEQAQLPRW
VAARAKQLNLELDDAANQVLCYCYEGNLLALAQALERLSLLWPDGKLTLP
RVEQAVNDAAHFTPFHWVDALLMGKSKRALHILQQLRLEGSEPVILLRTL
QRELLLLVNLKRQSAHTPLRALFDKHRVWQNRRGMMGEALNRLSQTQLRQ
AVQLLTRTELTLKQDYGQSVWAELEGLSLLLCHKPLADVFIDG

References:

Title Authors Journal
Genes encoding two lipoproteins in the leuS-dacA region of the Escherichia coli chromosome. Takase I, Ishino F, Wachi M, Kamata H, Doi M, Asoh S, Matsuzawa H, Ohta T, Matsuhashi M J Bacteriol Dec. 1, 1987
Accessory protein function in the DNA polymerase III holoenzyme from E. coli. O'Donnell M Bioessays Jan. 1, 1992
Molecular cloning, sequencing, and overexpression of the structural gene encoding the delta subunit of Escherichia coli DNA polymerase III holoenzyme. Carter JR, Franden MA, Aebersold R, McHenry CS J Bacteriol Nov. 1, 1992
DNA polymerase III accessory proteins. I. holA and holB encoding delta and delta'. Dong Z, Onrust R, Skangalis M, O'Donnell M J Biol Chem June 5, 1993
DNA polymerase III accessory proteins. II. Characterization of delta and delta'. Onrust R, O'Donnell M J Biol Chem June 5, 1993
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. DNA Res June 1, 1996
The complete genome sequence of Escherichia coli K-12. Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y Science Sept. 5, 1997
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T Mol Syst Biol Jan. 1, 2006


Last modification of this entry: Oct. 12, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.
Valid HTML 4.01! This site is Emacs powered. Made with Django.