Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
DnaX |
Protein FULL name:
DNA polymerase III subunit tau; Contains: DNA polymerase III subunit gamma.
DnaX (Escherichia coli strain K-12 substr. MG1655) is product of expression of dnaX gene.
DnaX is involved in:
MMR in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: DNA polymerase III is a complex, multichain enzyme responsible for most of the replicative synthesis in bacteria. This DNA polymerase also exhibits 3' to 5' exonuclease activity.
FUNCTION: The tau chain serves as a scaffold to help in the dimerizaton of the core complex.
FUNCTION: The gamma chain seems to interact with the delta subunit to transfer the beta subunit on the DNA.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
SUBUNIT: The DNA polymerase holoenzyme is a complex that contains 10 different types of subunits. These subunits are organized into 3 functionally essential subassemblies: the pol III core, the beta sliding clamp processivity factor and the clamp-loading complex. The pol III core (subunits alpha,epsilon and theta) contains the polymerase and the 3'-5' exonuclease proofreading activities. The polymerase is tethered to the template via the sliding clamp processivity factor. The clamp-loading complex assembles the beta processivity factor onto the primer template and plays a central role in the organization and communication at the replication fork. This complex contains delta, delta', psi and chi, and copies of either or both of two different dnaX proteins, gamma and tau. The composition of the holoenzyme is, therefore: (alpha,epsilon,theta)[2]-(gamma/tau)[3]-delta,delta', psi,chi- beta[4].
INTERACTION: P0A988:dnaN; NbExp=1; IntAct=EBI-549140, EBI-542385; P0A7L0:rplA; NbExp=1; IntAct=EBI-549140, EBI-543771;
MISCELLANEOUS: The production of the two protein products from this region is due to programmed ribosomal frameshifting.
SEQUENCE CAUTION: Sequence=CAA28175.1; Type=Erroneous initiation;
This protein can be a part of a given complexes:
| NCBI GenPept GI number(s): |
118808 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P06710 |
P06710 |
| PFAM: |
PF00004 PF12168 PF12170 |
PF00004 PF12168 PF12170 |
| InterPro: |
IPR003593 IPR003959 IPR001270 IPR008921 IPR022001 IPR012763 IPR021029 |
IPR003593 IPR003959 IPR001270 IPR008921 IPR022001 IPR012763 IPR021029 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSYQVLARKWRPQTFADVVGQEHVLTALANGLSLGRIHHAYLFSGTRGVG KTSIARLLAKGLNCETGITATPCGVCDNCREIEQGRFVDLIEIDAASRTK VEDTRDLLDNVQYAPARGRFKVYLIDEVHMLSRHSFNALLKTLEEPPEHV KFLLATTDPQKLPVTILSRCLQFHLKALDVEQIRHQLEHILNEEHIAHEP RALQLLARAAEGSLRDALSLTDQAIASGDGQVSTQAVSAMLGTLDDDQAL SLVEAMVEANGERVMALINEAAARGIEWEALLVEMLGLLHRIAMVQLSPA ALGNDMAAIELRMRELARTIPPTDIQLYYQTLLIGRKELPYAPDRRMGVE MTLLRALAFHPRMPLPEPEVPRQSFAPVAPTAVMTPTQVPPQPQSAPQQA PTVPLPETTSQVLAARQQLQRVQGATKAKKSEPAAATRARPVNNAALERL ASVTDRVQARPVPSALEKAPAKKEAYRWKATTPVMQQKEVVATPKALKKA LEHEKTPELAAKLAAEAIERDPWAAQVSQLSLPKLVEQVALNAWKEESDN AVCLHLRSSQRHLNNRGAQQKLAEALSMLKGSTVELTIVEDDNPAVRTPL EWRQAIYEEKLAQARESIIADNNIQTLRRFFDAELDEESIRPI |
References:
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|