Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Nei |
Protein FULL name:
5-formyluracil/5-hydroxymethyluracil DNA glycosylase [Escherichia coli str. K-12 substr. MG1655].
Nei (Escherichia coli strain K-12 substr. MG1655) is product of expression of nei gene.
Nei is involved in:
BER in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Involved in base excision repair of DNA damaged by oxidation or by mutagenic agents. Acts as DNA glycosylase that recognizes and removes damaged bases. Has a preference for oxidized pyrimidines, such as thymine glycol, 5,6-dihydrouracil and 5,6-dihydrothymine. Has AP (apurinic/apyrimidinic) lyase activity and introduces nicks in the DNA strand. Cleaves the DNA backbone by beta-delta elimination to generate a single-strand break at the site of the removed base with both 3'- and 5'- phosphates.
CATALYTIC ACTIVITY: Removes damaged bases from DNA, leaving an abasic site.
CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.
COFACTOR: Binds 1 zinc ion per subunit.
SIMILARITY: Belongs to the FPG family.
SIMILARITY: Contains 1 FPG-type zinc finger.
| NCBI GenPept GI number(s): |
16128689 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P50465 |
P50465 |
| PFAM: | - |
P50465 (Link - using uniprot id) |
| InterPro: | - |
P50465 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MPEGPEIRRAADNLEAAIKGKPLTDVWFAFPQLKPYQSQLIGQHVTHVET RGKALLTHFSNDLTLYSHNQLYGVWRVVDTGEEPQTTRVLRVKLQTADKT ILLYSASDIEMLTPEQLTTHPFLQRVGPDVLDPNLTPEVVKERLLSPRFR NRQFAGLLLDQAFLAGLGNYLRVEILWQVGLTGNHKAKDLNAAQLDALAH ALLEIPRFSYATRGQVDENKHHGALFRFKVFHRDGEPCERCGSIIEKTTL SSRPFYWCPGCQH |
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|