Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
XthA |
Protein FULL name:
exonuclease III [Escherichia coli str. K-12 substr. MG1655].
XthA (Escherichia coli strain K-12 substr. MG1655) is product of expression of xthA gene.
XthA is involved in:
BER in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Major apurinic-apyrimidinic endonuclease of E.coli. It removes the damaged DNA at cytosines and guanines by cleaving on the 3'-side of the AP site by a beta-elimination reaction. It exhibits 3'-5'-exonuclease, 3'-phosphomonoesterase, 3'-repair diesterase and ribonuclease H activities.
CATALYTIC ACTIVITY: Exonucleolytic cleavage in the 3'- to 5'- direction to yield nucleoside 5'-phosphates.
SUBUNIT: Monomer.
SIMILARITY: Belongs to the DNA repair enzymes AP/exoA family.
WEB RESOURCE: Name=Wikipedia; Note=Exonuclease III entry; [LINK]
| NCBI GenPept GI number(s): |
16129703 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P09030 |
P09030 |
| PFAM: | - |
P09030 (Link - using uniprot id) |
| InterPro: | - |
P09030 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKFVSFNINGLRARPHQLEAIVEKHQPDVIGLQETKVHDDMFPLEEVAKL GYNVFYHGQKGHYGVALLTKETPIAVRRGFPGDDEEAQRRIIMAEIPSLL GNVTVINGYFPQGESRDHPIKFPAKAQFYQNLQNYLETELKRDNPVLIMG DMNISPTDLDIGIGEENRKRWLRTGKCSFLPEEREWMDRLMSWGLVDTFR HANPQTADRFSWFDYRSKGFDDNRGLRIDLLLASQPLAECCVETGIDYEI RSMEKPSDHAPVWATFRR |
XthA (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Nucleotide sequence of the xth gene of Escherichia coli K-12. | Saporito SM, Smith-White BJ, Cunningham RP | J Bacteriol Oct. 1, 1988 |
| Structure and function of the multifunctional DNA-repair enzyme exonuclease III. | Mol CD, Kuo CF, Thayer MM, Cunningham RP, Tainer JA | Nature March 23, 1995 |
| Cleavage of single- and double-stranded DNAs containing an abasic residue by Escherichia coli exonuclease III (AP endonuclease VI). | Shida T, Noda M, Sekiguchi J | Nucleic Acids Res Nov. 15, 1996 |
| A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. | Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al. | DNA Res Dec. 31, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|