Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Nfo |
Protein FULL name:
endonuclease IV with intrinsic 3'-5' exonuclease activity [Escherichia coli str. K-12 substr. MG1655].
Nfo (Escherichia coli strain K-12 substr. MG1655) is product of expression of nfo gene.
Nfo is involved in:
BER in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Endonuclease IV plays a role in DNA repair. It cleaves phosphodiester bonds at apurinic or apyrimidinic sites (AP sites) to produce new 5'-ends that are base-free deoxyribose 5-phosphate residues. It preferentially attacks modified AP sites created by bleomycin and neocarzinostatin.
CATALYTIC ACTIVITY: Endonucleolytic cleavage to 5'- phosphooligonucleotide end-products.
COFACTOR: Binds 3 zinc ions. Can also bind manganese.
SUBUNIT: Monomer.
INDUCTION: Endonuclease IV is induced by agents which generate superoxide radical anions.
SIMILARITY: Belongs to the AP endonuclease 2 family.
| NCBI GenPept GI number(s): |
16130097 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A6C1 |
P0A6C1 |
| PFAM: | - |
P0A6C1 (Link - using uniprot id) |
| InterPro: | - |
P0A6C1 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKYIGAHVSAAGGLANAAIRAAEIDATAFALFTKNQRQWRAAPLTTQTID EFKAACEKYHYTSAQILPHDSYLINLGHPVTEALEKSRDAFIDEMQRCEQ LGLSLLNFHPGSHLMQISEEDCLARIAESINIALDKTQGVTAVIENTAGQ GSNLGFKFEHLAAIIDGVEDKSRVGVCIDTCHAFAAGYDLRTPAECEKTF ADFARTVGFKYLRGMHLNDAKSTFGSRVDRHHSLGEGNIGHDAFRWIMQD DRFDGIPLILETINPDIWAEEIAWLKAQQTEKAVA |
Nfo (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
Last modification of this entry: Oct. 14, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|