Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
DnaT |
Protein FULL name:
DNA biosynthesis protein (primosomal protein I) [Escherichia coli str. K-12 substr. MG1655].
DnaT (Escherichia coli strain K-12 substr. MG1655) is product of expression of dnaT gene.
DnaT is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: This protein is required for primosome-dependent normal DNA replication; it is also involved in inducing stable DNA replication during SOS response. It forms, in concert with dnaB protein and other prepriming proteins dnaC, N, N', N'' a prepriming protein complex on the specific site of the template DNA recognized by protein N'.
INTERACTION: Q9F505:yheB (xeno); NbExp=1; IntAct=EBI-549621, EBI-549635;
SIMILARITY: Belongs to the dnaT family.
| NCBI GenPept GI number(s): |
16132183 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A8J2 |
P0A8J2 |
| PFAM: | - |
P0A8J2 (Link - using uniprot id) |
| InterPro: | - |
P0A8J2 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSSRVLTPDVVGIDALVHDHQTVLAKAEGGVVAVFANNAPAFYAVTPARL AELLALEEKLARPGSDVALDDQLYQEPQAAPVAVPMGKFAMYPDWQPDAD FIRLAALWGVALREPVTTEELASFIAYWQAEGKVFHHVQWQQKLARSLQI GRASNGGLPKRDVNTVSEPDSQIPPGFRG |
References:
| Title | Authors | Journal |
| Cloning of the Escherichia coli gene for primosomal protein i: the relationship to dnaT, essential for chromosomal DNA replication. | Masai H, Bond MW, Arai K | Proc Natl Acad Sci U S A March 1, 1986 |
| Structure of Escherichia coli dnaC. Identification of a cysteine residue possibly involved in association with dnaB protein. | Nakayama N, Bond MW, Miyajima A, Kobori J, Arai K | J Biol Chem Aug. 5, 1987 |
| Operon structure of dnaT and dnaC genes essential for normal and stable DNA replication of Escherichia coli chromosome. | Masai H, Arai K | J Biol Chem Oct. 15, 1988 |
| Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes. | Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL, Blattner FR | Nucleic Acids Res June 25, 1995 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|