Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RecR |
Protein FULL name:
gap repair protein [Escherichia coli str. K-12 substr. MG1655].
RecR (Escherichia coli strain K-12 substr. MG1655) is product of expression of recR gene.
RecR is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
- RecA and RecFOR join and start the filament formation in Escherichia coli strain K-12 substr. MG1655
FUNCTION: May play a role in DNA repair. It seems to be involved in an recBC-independent recombinational process of DNA repair. It may act with recF and recO.
SIMILARITY: Belongs to the recR family.
SIMILARITY: Contains 1 Toprim domain.
| NCBI GenPept GI number(s): |
16128456 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A7H6 |
P0A7H6 |
| PFAM: | - |
P0A7H6 (Link - using uniprot id) |
| InterPro: | - |
P0A7H6 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MQTSPLLTQLMEALRCLPGVGPKSAQRMAFTLLQRDRSGGMRLAQALTRA MSEIGHCADCRTFTEQEVCNICSNPRRQENGQICVVESPADIYAIEQTGQ FSGRYFVLMGHLSPLDGIGPDDIGLDRLEQRLAEEKITEVILATNPTVEG EATANYIAELCAQYDVEASRIAHGVPVGGELEMVDGTTLSHSLAGRHKIR F |
References:
| Title | Authors | Journal |
| The recR locus of Escherichia coli K-12: molecular cloning, DNA sequencing and identification of the gene product. | Mahdi AA, Lloyd RG | Nucleic Acids Res Sept. 12, 1989 |
| Sequence and expression of the Escherichia coli recR locus. | Yeung T, Mullin DA, Chen KS, Craig EA, Bardwell JC, Walker JR | J Bacteriol Oct. 1, 1990 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|