REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

Apn1p

Protein FULL name:

apurinic/apyrimidinic (AP) lyase 1

Apn1p (Saccharomyces cerevisiae) is product of expression of APN1 gene.

Apn1p is involved in:

BER in Saccharomyces cerevisiae

Keywords:

FUNCTION: DNA repair enzyme that cleaves apurinic/apyrimidinic (AP) sites and removes 3'-blocking groups present at single strand breaks of damaged DNA. APN1 accounts for > 97% of both apurinic/ apyrimidinic (AP) lyase and DNA 3'-repair diesterase activities.

CATALYTIC ACTIVITY: The C-O-P bond 3' to the apurinic or apyrimidinic site in DNA is broken by a beta-elimination reaction, leaving a 3'-terminal unsaturated sugar and a product with a terminal 5'-phosphate.

COFACTOR: Binds 3 zinc ions.

SUBUNIT: Monomer.

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 7250 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the AP endonuclease 2 family.

NCBI GenPept GI number(s):	296146264
Species:	Saccharomyces cerevisiae

Links to other databases:

Database	ID	Link
Uniprot	P22936	P22936
PFAM:	-	P22936 (Link - using uniprot id)
InterPro:	-	P22936 (Link - using uniprot id)
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MPSTPSFVRSAVSKYKFGAHMSGAGGISNSVTNAFNTGCNSFAMFLKSPR
KWVSPQYTQEEIDKFKKNCATYNYNPLTDVLPHGQYFINLANPDREKAEK
SYESFMDDLNRCEQLGIGLYNLHPGSTLKGDHQLQLKQLASYLNKAIKET
KFVKIVLENMAGTGNLVGSSLVDLKEVIGMIEDKSRIGVCIDTCHTFAAG
YDISTTETFNNFWKEFNDVIGFKYLSAVHLNDSKAPLGANRDLHERLGQG
YLGIDVFRMIAHSEYLQGIPIVLETPYENDEGYGNEIKLMEWLESKSESE
LLEDKEYKEKNDTLQKLGAKSRKEQLDKFEVKQKKRAGGTKRKKATAEPS
DNDILSQMTKKRKTKKE

References:

Title	Authors	Journal
Yeast DNA diesterase for 3'-fragments of deoxyribose: purification and physical properties of a repair enzyme for oxidative DNA damage.	Johnson AW, Demple B	J Biol Chem Dec. 5, 1988
Yeast structural gene (APN1) for the major apurinic endonuclease: homology to Escherichia coli endonuclease IV.	Popoff SC, Spira AI, Johnson AW, Demple B	Proc Natl Acad Sci U S A June 1, 1990
Metalloenzymes in DNA repair. Escherichia coli endonuclease IV and Saccharomyces cerevisiae Apn1.	Levin JD, Shapiro R, Demple B	J Biol Chem Dec. 5, 1991
Sequence of a 10.7 kb segment of yeast chromosome XI identifies the APN1 and the BAF1 loci and reveals one tRNA gene and several new open reading frames including homologs to RAD2 and kinases.	Jacquier A, Legrain P, Dujon B	Yeast Jan. 1, 1992
Complete DNA sequence of yeast chromosome XI.	Dujon B, Alexandraki D, Andre B, Ansorge W, Baladron V, Ballesta JP, Banrevi A, Bolle PA, Bolotin-Fukuhara M, Bossier P, et al.	Nature June 2, 1994
Global analysis of protein expression in yeast.	Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS	Nature Oct. 16, 2003
A multidimensional chromatography technology for in-depth phosphoproteome analysis.	Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H	Mol Cell Proteomics July 1, 2008

Last modification of this entry: Oct. 16, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.