Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Mag1p |
Protein FULL name:
3-methyl-adenine DNA glycosylase involved in protecting DNA against alkylating agents; initiates base excision repair by removing damaged bases to create abasic sites that are subsequently repaired
Protein SHORT name:
MMS5
Mag1p (Saccharomyces cerevisiae) is product of expression of MAG1 gene.
Mag1p is involved in:
BER in Saccharomyces cerevisiae
- Monofunctional glycosylase recognizes damaged DNA in Saccharomyces cerevisiae
- Lesion recognition and removal by monofunctional glycosylase in Saccharomyces cerevisiae
Keywords:
FUNCTION: Hydrolysis of the deoxyribose N-glycosidic bond to excise 3-methyladenine or 7-methyladenine from the damaged DNA polymer formed by alkylation lesions.
CATALYTIC ACTIVITY: Hydrolysis of alkylated DNA, releasing 3- methyladenine, 3-methylguanine, 7-methylguanine and 7- methyladenine.
INTERACTION: P04817:CAN1; NbExp=1; IntAct=EBI-10381, EBI-3993;
SUBCELLULAR LOCATION: Nucleus.
INDUCTION: By DNA damage.
SIMILARITY: Belongs to the alkylbase DNA glycosidase alkA family.
| NCBI GenPept GI number(s): |
6320990 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P22134 |
P22134 |
| PFAM: | - |
P22134 (Link - using uniprot id) |
| InterPro: | - |
P22134 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKLKREYDELIKADAVKEIAKELGSRPLEVALPEKYIARHEEKFNMACEH ILEKDPSLFPILKNNEFTLYLKETQVPNTLEDYFIRLASTILSQQISGQA AESIKARVVSLYGGAFPDYKILFEDFKDPAKCAEIAKCGLSKRKMIYLES LAVYFTEKYKDIEKLFGQKDNDEEVIESLVTNVKGIGPWSAKMFLISGLK RMDVFAPEDLGIARGFSKYLSDKPELEKELMRERKVVKKSKIKHKKYNWK IYDDDIMEKCSETFSPYRSVFMFILWRLASTNTDAMMKAEENFVKS |
Mag1p (Saccharomyces cerevisiae) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Cloning and expression in Escherichia coli of a gene for an alkylbase DNA glycosylase from Saccharomyces cerevisiae; a homologue to the bacterial alkA gene. | Berdal KG, Bjoras M, Bjelland S, Seeberg E | EMBO J Dec. 1, 1990 |
| Saccharomyces cerevisiae 3-methyladenine DNA glycosylase has homology to the AlkA glycosylase of E. coli and is induced in response to DNA alkylation damage. | Chen J, Derfler B, Samson L | EMBO J Dec. 1, 1990 |
| Purification and properties of the alkylation repair DNA glycosylase encoded the MAG gene from Saccharomyces cerevisiae. | Bjoras M, Klungland A, Johansen RF, Seeberg E | Biochemistry April 11, 1995 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome V. | Dietrich FS, Mulligan J, Hennessy K, Yelton MA, Allen E, Araujo R, Aviles E, Berno A, Brennan T, Carpenter J, Chen E, Cherry JM, Chung E, Duncan M, Guzman E, Hartzell G, Hunicke-Smith S, Hyman RW, Kayser A, Komp C, Lashkari D, Lew H, Lin D, Mosedale D, Davis RW, et al. | Nature May 1, 1997 |
| Yeast mitochondrial dehydrogenases are associated in a supramolecular complex. | Grandier-Vazeille X, Bathany K, Chaignepain S, Camougrand N, Manon S, Schmitter JM | Biochemistry Aug. 21, 2001 |
| Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. | Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J | Genome Res April 1, 2007 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 13, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|