REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.
Home
Proteins
DNA damage
Diseases
Homologs
Pathways
Keywords
Publications
Draw a picture
 
Search
 
Links
Help
Contact





Bujnicki Lab Homepage

Rfc5p
Rfc5p (Saccharomyces cerevisiae) is product of expression of RFC5 gene.

Rfc5p is involved in:

MMR in Saccharomyces cerevisiae NER in Saccharomyces cerevisiae


FUNCTION: Component of ATP-dependent clamp loader (RFC and RFC- like) complexes for DNA clamps, such as the POL30/PCNA homotrimer and the checkpoint clamp DDC1:MEC3:RAD17 complex. During a clamp loading circle, the RFC:clamp complex binds to DNA and the recognition of the double-stranded/single-stranded junction stimulates ATP hydrolysis by RFC. The complex presumably provides bipartite ATP sites in which one subunit supplies a catalytic site for hydrolysis of ATP bound to the neighboring subunit. Dissociation of RFC from the clamp leaves the clamp encircling DNA. Component of the replication factor C (RFC or activator 1) complex which loads POL30/PCNA and acts during elongation of primed DNA templates by DNA polymerase delta and epsilon. RFC has an essential but redundant activity in sister chromatid cohesion establishment. Component of the RFC-like complex CTF18-RFC which is required for efficient establishment of chromosome cohesion during S-phase and may load or unload POL30/PCNA. Component of the RFC-like RAD24-RFC complex which loads the checkpoint clamp DDC1:MEC3:RAD17 complex and is involved in DNA repair pathways. Component of the RFC-like ELG1-RFC complex which appears to have a role in DNA replication, replication fork re-start, recombination and repair.

SUBUNIT: Replication factor C (RFC) is a heteropentamer of subunits RFC1, RFC2, RFC3, RFC4 and RFC5 and forms a complex with POL30/PCNA in the presence of ATP. Component of the RAD24-RFC complex which consists of RAD14, RFC2, RFC3, RFC4 and RFC5 and associates with the checkpoint clamp DDC1:MEC3:RAD17 complex. Component of the ELG1-RFC complex which consists of ELG1, RFC2, RFC3, RFC4 and RFC5. Component of the CTF18-RFC complex, which consists of CTF18, CTF8, DCC1, RFC2, RFC3, RFC4 and RFC5. RFC5 interacts with ECO1.

INTERACTION: P49956:CTF18; NbExp=2; IntAct=EBI-15016, EBI-4560; P38877:CTF8; NbExp=1; IntAct=EBI-15016, EBI-5216; P43605:ECO1; NbExp=1; IntAct=EBI-15016, EBI-22988; Q12050:ELG1; NbExp=2; IntAct=EBI-15016, EBI-32195; P32641:RAD24; NbExp=2; IntAct=EBI-15016, EBI-14675;

SUBCELLULAR LOCATION: Nucleus (Probable).

MISCELLANEOUS: Present with 5040 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the activator 1 small subunits family.

NCBI GenPept GI number(s): 296142756
Species: Saccharomyces cerevisiae

Links to other databases:

Database ID Link
Uniprot P38251 P38251
PFAM: - P38251 (Link - using uniprot id)
InterPro: - P38251 (Link - using uniprot id)
CATH: - -
SCOP: - -
PDB: - -


Protein sequence:
MSLWVDKYRPKSLNALSHNEELTNFLKSLSDQPRDLPHLLLYGPNGTGKK
TRCMALLESIFGPGVYRLKIDVRQFVTASNRKLELNVVSSPYHLEITPSD
MGNNDRIVIQELLKEVAQMEQVDFQDSKDGLAHRYKCVIINEANSLTKDA
QAALRRTMEKYSKNIRLIMVCDSMSPIIAPIKSRCLLIRCPAPSDSEIST
ILSDVVTNERIQLETKDILKRIAQASNGNLRVSLLMLESMALNNELALKS
SSPIIKPDWIIVIHKLTRKIVKERSVNSLIECRAVLYDLLAHCIPANIIL
KELTFSLLDVETLNTTNKSSIIEYSSVFDERLSLGNKAIFHLEGFIAKVM
CCLD

References:

Title Authors Journal
Analysis of a 70 kb region on the right arm of yeast chromosome II. Mannhaupt G, Stucka R, Ehnle S, Vetter I, Feldmann H Yeast Oct. 1, 1994
Complete DNA sequence of yeast chromosome II. Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, et al. EMBO J Dec. 15, 1994
Characterization of the five replication factor C genes of Saccharomyces cerevisiae. Cullmann G, Fien K, Kobayashi R, Stillman B Mol Cell Biol Sept. 1, 1995
Identification of the fifth subunit of Saccharomyces cerevisiae replication factor C. Gary SL, Burgers MJ Nucleic Acids Res Dec. 25, 1995
Rfc5, in cooperation with rad24, controls DNA damage checkpoints throughout the cell cycle in Saccharomyces cerevisiae. Naiki T, Shimomura T, Kondo T, Matsumoto K, Sugimoto K Mol Cell Biol Aug. 1, 2000
Identification of RFC(Ctf18p, Ctf8p, Dcc1p): an alternative RFC complex required for sister chromatid cohesion in S. cerevisiae. Mayer ML, Gygi SP, Aebersold R, Hieter P Mol Cell May 1, 2001
Chl12 (Ctf18) forms a novel replication factor C-related complex and functions redundantly with Rad24 in the DNA replication checkpoint pathway. Naiki T, Kondo T, Nakada D, Matsumoto K, Sugimoto K Mol Cell Biol Sept. 1, 2001
Yeast Rad17/Mec3/Ddc1: a sliding clamp for the DNA damage checkpoint. Majka J, Burgers PM Proc Natl Acad Sci U S A March 4, 2003
Mechanical link between cohesion establishment and DNA replication: Ctf7p/Eco1p, a cohesion establishment factor, associates with three different replication factor C complexes. Kenna MA, Skibbens RV Mol Cell Biol April 1, 2003
Elg1 forms an alternative RFC complex important for DNA replication and genome integrity. Bellaoui M, Chang M, Ou J, Xu H, Boone C, Brown GW EMBO J Aug. 15, 2003
Global analysis of protein expression in yeast. Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS Nature Oct. 16, 2003
Structural analysis of a eukaryotic sliding DNA clamp-clamp loader complex. Bowman GD, O'Donnell M, Kuriyan J Nature June 17, 2004
Replication protein A-directed unloading of PCNA by the Ctf18 cohesion establishment complex. Bylund GO, Burgers PM Mol Cell Biol July 1, 2005
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae. Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J Genome Res April 1, 2007

Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.
Welcome stranger! Click here to login or here to register.

Copyright - Genesilico
All rights reserved

 Valid HTML 4.01! This site is Emacs powered. Made with Django.