Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Exo1p |
Protein FULL name:
5'-3' exonuclease and flap-endonuclease involved in recombination, double-strand break repair and DNA mismatch repair; member of the Rad2p nuclease family, with conserved N and I nuclease domains
Exo1p (Saccharomyces cerevisiae) is product of expression of EXO1 gene.
Exo1p is involved in:
MMR in Saccharomyces cerevisiae
Keywords:
FUNCTION: 5'->3' double-stranded DNA exonuclease involved in mismatch repair and eventually also in mitotic recombination between direct repeats. Also has a minor role in the correction of large DNA mismatches that occur in the heteroduplex DNA during meiotic recombination at the HIS4 locus.
COFACTOR: Binds 2 magnesium ions per subunit. They probably participate in the reaction catalyzed by the enzyme. May bind an additional third magnesium ion after substrate binding (By similarity).
ENZYME REGULATION: Inactivated by calcium and zinc ions.
SUBUNIT: Interacts with mismatch repair protein MSH2.
INTERACTION: P25847:MSH2; NbExp=3; IntAct=EBI-6738, EBI-11352; P43246:MSH2 (xeno); NbExp=1; IntAct=EBI-6738, EBI-355888;
SUBCELLULAR LOCATION: Nucleus (Potential).
MISCELLANEOUS: Present with 672 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the XPG/RAD2 endonuclease family. EXO1 subfamily.
| NCBI GenPept GI number(s): |
6324607 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P39875 |
P39875 |
| PFAM: | - |
P39875 (Link - using uniprot id) |
| InterPro: | - |
P39875 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MGIQGLLPQLKPIQNPVSLRRYEGEVLAIDGYAWLHRAACSCAYELAMGK PTDKYLQFFIKRFSLLKTFKVEPYLVFDGDAIPVKKSTESKRRDKRKENK AIAERLWACGEKKNAMDYFQKCVDITPEMAKCIICYCKLNGIRYIVAPFE ADSQMVYLEQKNIVQGIISEDSDLLVFGCRRLITKLNDYGECLEICRDNF IKLPKKFPLGSLTNEEIITMVCLSGCDYTNGIPKVGLITAMKLVRRFNTI ERIILSIQREGKLMIPDTYINEYEAAVLAFQFQRVFCPIRKKIVSLNEIP LYLKDTESKRKRLYACIGFVIHRETQKKQIVHFDDDIDHHLHLKIAQGDL NPYDFHQPLANREHKLQLASKSNIEFGKTNTTNSEAKVKPIESFFQKMTK LDHNPKVANNIHSLRQAEDKLTMAIKRRKLSNANVVQETLKDTRSKFFNK PSMTVVENFKEKGDSIQDFKEDTNSQSLEEPVSESQLSTQIPSSFITTNL EDDDNLSEEVSEVVSDIEEDRKNSEGKTIGNEIYNTDDDGDGDTSEDYSE TAESRVPTSSTTSFPGSSQRSISGCTKVLQKFRYSSSFSGVNANRQPLFP RHVNQKSRGMVYVNQNRDDDCDDNDGKNQITQRPSLRKSLIGARSQRIVI DMKSVDERKSFNSSPILHEESKKRDIETTKSSQARPAVRSISLLSQFVYK GK |
Exo1p (Saccharomyces cerevisiae) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Molecular cloning of a gene, DHS1, which complements a drug-hypersensitive mutation of the yeast Saccharomyces cerevisiae. | Lee YS, Shimizu J, Yoda K, Yamasaki M | Biosci Biotechnol Biochem Jan. 1, 1994 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. | Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. | Nature May 1, 1997 |
| Exonuclease I of Saccharomyces cerevisiae functions in mitotic recombination in vivo and in vitro. | Fiorentini P, Huang KN, Tishkoff DX, Kolodner RD, Symington LS | Mol Cell Biol May 1, 1997 |
| Identification and characterization of Saccharomyces cerevisiae EXO1, a gene encoding an exonuclease that interacts with MSH2. | Tishkoff DX, Boerger AL, Bertrand P, Filosi N, Gaida GM, Kane MF, Kolodner RD | Proc Natl Acad Sci U S A July 8, 1997 |
| Decreased meiotic intergenic recombination and increased meiosis I nondisjunction in exo1 mutants of Saccharomyces cerevisiae. | Kirkpatrick DT, Ferguson JR, Petes TD, Symington LS | Genetics Dec. 1, 2000 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Exo1 processes stalled replication forks and counteracts fork reversal in checkpoint-defective cells. | Cotta-Ramusino C, Fachinetti D, Lucca C, Doksani Y, Lopes M, Sogo J, Foiani M | Mol Cell Feb. 7, 2005 |
| Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. | Smolka MB, Albuquerque CP, Chen SH, Zhou H | Proc Natl Acad Sci U S A June 19, 2007 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|