REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

Ssl2p

Protein FULL name:

Component of the holoenzyme form of RNA polymerase transcription factor TFIIH, has DNA-dependent ATPase/helicase activity and is required, with Rad3p, for unwinding promoter DNA; involved in DNA repair; homolog of human ERCC3

Ssl2p (Saccharomyces cerevisiae) is product of expression of SSL2 gene.

Ssl2p is involved in:

NER in Saccharomyces cerevisiae

FUNCTION: Probably an ATP-dependent DNA helicase, which may have a DNA unwinding function. Has an essential function in translation initiation. Acts as component of the general transcription and DNA repair factor IIH (TFIIH) core, which is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has CTD kinase and DNA-dependent ATPase activity, and is essential for polymerase II transcription in vitro.

CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.

SUBUNIT: Component of the TFIIH core complex, which is composed of RAD3, SSL1, SSL2, TFB1, TFB2, TFB4 and TFB5.

INTERACTION: P54113:ADE16; NbExp=1; IntAct=EBI-14683, EBI-14213; P54783:ALO1; NbExp=1; IntAct=EBI-14683, EBI-2519; P38328:ARC40; NbExp=1; IntAct=EBI-14683, EBI-2777; P53090:ARO8; NbExp=1; IntAct=EBI-14683, EBI-2042933; P32288:GLN1; NbExp=1; IntAct=EBI-14683, EBI-7665; P00817:IPP1; NbExp=1; IntAct=EBI-14683, EBI-9338; P09938:RNR2; NbExp=1; IntAct=EBI-14683, EBI-15240; P41811:SEC27; NbExp=1; IntAct=EBI-14683, EBI-4898; P16965:STF2; NbExp=1; IntAct=EBI-14683, EBI-2045666; P07806:VAS1; NbExp=1; IntAct=EBI-14683, EBI-18825; P22203:VMA4; NbExp=1; IntAct=EBI-14683, EBI-20268;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: A C-terminal deletion renders yeast hypersensitive to UV light.

MISCELLANEOUS: Present with 825 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the helicase family. RAD25/XPB subfamily.

SIMILARITY: Contains 1 helicase ATP-binding domain.

SIMILARITY: Contains 1 helicase C-terminal domain.

This protein can be a part of a given complexes:

Transcription factor II H core

NCBI GenPept GI number(s):	6322048
Species:	Saccharomyces cerevisiae

Links to other databases:

Database	ID	Link
Uniprot	Q00578	Q00578
PFAM:	-	Q00578 (Link - using uniprot id)
InterPro:	-	Q00578 (Link - using uniprot id)
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MTDVEGYQPKSKGKIFPDMGESFFSSDEDSPATDAEIDENYDDNRETSEG
RGERDTGAMVTGLKKPRKKTKSSRHTAADSSMNQMDAKDKALLQDTNSDI
PADFVPDSVSGMFRSHDFSYLRLRPDHASRPLWISPSDGRIILESFSPLA
EQAQDFLVTIAEPISRPSHIHEYKITAYSLYAAVSVGLETDDIISVLDRL
SKVPVAESIINFIKGATISYGKVKLVIKHNRYFVETTQADILQMLLNDSV
IGPLRIDSDHQVQPPEDVLQQQLQQTAGKPATNVNPNDVEAVFSAVIGGD
NEREEEDDDIDAVHSFEIANESVEVVKKRCQEIDYPVLEEYDFRNDHRNP
DLDIDLKPSTQIRPYQEKSLSKMFGNGRARSGIIVLPCGAGKTLVGITAA
CTIKKSVIVLCTSSVSVMQWRQQFLQWCTLQPENCAVFTSDNKEMFQTES
GLVVSTYSMVANTRNRSHDSQKVMDFLTGREWGFIILDEVHVVPAAMFRR
VVSTIAAHAKLGLTATLVREDDKIGDLNFLIGPKLYEANWMELSQKGHIA
NVQCAEVWCPMTAEFYQEYLRETARKRMLLYIMNPTKFQACQFLIQYHER
RGDKIIVFSDNVYALQEYALKMGKPFIYGSTPQQERMNILQNFQYNDQIN
TIFLSKVGDTSIDLPEATCLIQISSHYGSRRQEAQRLGRILRAKRRNDEG
FNAFFYSLVSKDTQEMYYSTKRQAFLVDQGYAFKVITHLHGMENIPNLAY
ASPRERRELLQEVLLKNEEAAGIEVGDDADNSVGRGSNGHKRFKSKAVRG
EGSLSGLAGGEDMAYMEYSTNKNKELKEHHPLIRKMYYKNLKK

References:

Title	Authors	Journal
SSL2, a suppressor of a stem-loop mutation in the HIS4 leader encodes the yeast homolog of human ERCC-3.	Gulyas KD, Donahue TF	Cell June 12, 1992
RAD25 (SSL2), the yeast homolog of the human xeroderma pigmentosum group B DNA repair gene, is essential for viability.	Park E, Guzder SN, Koken MH, Jaspers-Dekker I, Weeda G, Hoeijmakers JH, Prakash S, Prakash L	Proc Natl Acad Sci U S A Dec. 1, 1992
RNA polymerase transcription factor IIH holoenzyme from yeast.	Svejstrup JQ, Feaver WJ, LaPointe J, Kornberg RD	J Biol Chem Nov. 11, 1994
Reconstitution of TFIIH and requirement of its DNA helicase subunits, Rad3 and Rad25, in the incision step of nucleotide excision repair.	Sung P, Guzder SN, Prakash L, Prakash S	J Biol Chem May 3, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome IX.	Churcher C, Bowman S, Badcock K, Bankier A, Brown D, Chillingworth T, Connor R, Devlin K, Gentles S, Hamlin N, Harris D, Horsnell T, Hunt S, Jagels K, Jones M, Lye G, Moule S, Odell C, Pearson D, Rajandream M, Rice P, Rowley N, Skelton J, Smith V, Barrell B, et al.	Nature May 1, 1997
Global analysis of protein expression in yeast.	Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS	Nature Oct. 16, 2003
Revised subunit structure of yeast transcription factor IIH (TFIIH) and reconciliation with human TFIIH.	Takagi Y, Komori H, Chang WH, Hudmon A, Erdjument-Bromage H, Tempst P, Kornberg RD	J Biol Chem Nov. 7, 2003
Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae.	Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP	J Proteome Res March 1, 2007
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.	Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J	Genome Res April 1, 2007

Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.