REPAIRtoire - a database of DNA repair pathways

Welcome! Click here to login or here to register.

Home

Bujnicki Lab Homepage

Rad3p

Protein FULL name:

5' to 3' DNA helicase, involved in nucleotide excision repair and transcription; subunit of RNA polymerase II transcription initiation factor TFIIH; subunit of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPD protein

Rad3p (Saccharomyces cerevisiae) is product of expression of RAD3 gene.

Rad3p is involved in:

NER in Saccharomyces cerevisiae

FUNCTION: ATP-dependent DNA helicase involved in excision repair of DNA damaged with UV light, bulky adducts, or cross-linking agents. Necessary for excision of pyrimidine dimers. Also unwinds DNA/RNA duplexes. Plays an essential role in the cell viability. Involved in the maintenance of the fidelity of DNA replication. Acts as component of the general transcription and DNA repair factor IIH (TFIIH) core, which is essential for both basal and activated transcription, and is involved in nucleotide excision repair (NER) of damaged DNA. TFIIH has CTD kinase and DNA- dependent ATPase activity, and is essential for polymerase II transcription in vitro.

CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.

SUBUNIT: Component of the TFIIH core complex, which is composed of RAD3, SSL1, SSL2, TFB1, TFB2, TFB4 and TFB5.

INTERACTION: Q03290:TFB3; NbExp=1; IntAct=EBI-14762, EBI-31406;

SUBCELLULAR LOCATION: Nucleus.

MISCELLANEOUS: Present with 14400 molecules/cell in log phase SD medium.

SIMILARITY: Belongs to the helicase family. RAD3/XPD subfamily.

SIMILARITY: Contains 1 helicase ATP-binding domain.

This protein can be a part of a given complexes:

Transcription factor II H core

NCBI GenPept GI number(s):	6321019
Species:	Saccharomyces cerevisiae

Links to other databases:

Database	ID	Link
Uniprot	P06839	P06839
PFAM:	-	P06839 (Link - using uniprot id)
InterPro:	-	P06839 (Link - using uniprot id)
CATH:	-	-
SCOP:	-	-
PDB:	-	-

Protein sequence:

MKFYIDDLPVLFPYPKIYPEQYNYMCDIKKTLDVGGNSILEMPSGTGKTV
SLLSLTIAYQMHYPEHRKIIYCSRTMSEIEKALVELENLMDYRTKELGYQ
EDFRGLGLTSRKNLCLHPEVSKERKGTVVDEKCRRMTNGQAKRKLEEDPE
ANVELCEYHENLYNIEVEDYLPKGVFSFEKLLKYCEEKTLCPYFIVRRMI
SLCNIIIYSYHYLLDPKIAERVSNEVSKDSIVIFDEAHNIDNVCIESLSL
DLTTDALRRATRGANALDERISEVRKVDSQKLQDEYEKLVQGLHSADILT
DQEEPFVETPVLPQDLLTEAIPGNIRRAEHFVSFLKRLIEYLKTRMKVLH
VISETPKSFLQHLKQLTFIERKPLRFCSERLSLLVRTLEVTEVEDFTALK
DIATFATLISTYEEGFLLIIEPYEIENAAVPNPIMRFTCLDASIAIKPVF
ERFSSVIITSGTISPLDMYPRMLNFKTVLQKSYAMTLAKKSFLPMIITKG
SDQVAISSRFEIRNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESI
VSMWQTMGILDEVWKHKLILVETPDAQETSLALETYRKACSNGRGAILLS
VARGKVSEGIDFDHQYGRTVLMIGIPFQYTESRILKARLEFMRENYRIRE
NDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLADRRFSRKRSQLPKWIAQG
LSDADLNLSTDMAISNTKQFLRTMAQPTDPKDQEGVSVWSYEDLIKHQNS
RKDQGGFIENENKEGEQDEDEDEDIEMQ

References:

Title	Authors	Journal
RAD3 gene of Saccharomyces cerevisiae: nucleotide sequence of wild-type and mutant alleles, transcript mapping, and aspects of gene regulation.	Naumovski L, Chu G, Berg P, Friedberg EC	Mol Cell Biol Feb. 1, 1985
The nucleotide sequence of the RAD3 gene of Saccharomyces cerevisiae: a potential adenine nucleotide binding amino acid sequence and a nonessential acidic carboxyl terminal region.	Reynolds P, Higgins DR, Prakash L, Prakash S	Nucleic Acids Res April 11, 1985
Mutation of lysine-48 to arginine in the yeast RAD3 protein abolishes its ATPase and DNA helicase activities but not the ability to bind ATP.	Sung P, Higgins D, Prakash L, Prakash S	EMBO J Oct. 1, 1988
Effects of multiple yeast rad3 mutant alleles on UV sensitivity, mutability, and mitotic recombination.	Song JM, Montelone BA, Siede W, Friedberg EC	J Bacteriol Dec. 1, 1990
DNA.RNA helicase activity of RAD3 protein of Saccharomyces cerevisiae.	Bailly V, Sung P, Prakash L, Prakash S	Proc Natl Acad Sci U S A Nov. 1, 1991
The RAD3 gene is a member of the DEAH family RNA helicase-like protein.	Harosh I, Deschavanne P	Nucleic Acids Res Nov. 25, 1991
The Rad3 protein from Saccharomyces cerevisiae: a DNA and DNA:RNA helicase with putative RNA helicase activity.	Deschavanne PJ, Harosh I	Mol Microbiol March 1, 1993
Dual roles of a multiprotein complex from S. cerevisiae in transcription and DNA repair.	Feaver WJ, Svejstrup JQ, Bardwell L, Bardwell AJ, Buratowski S, Gulyas KD, Donahue TF, Friedberg EC, Kornberg RD	Cell Dec. 31, 1993
RNA polymerase transcription factor IIH holoenzyme from yeast.	Svejstrup JQ, Feaver WJ, LaPointe J, Kornberg RD	J Biol Chem Nov. 11, 1994
Reconstitution of TFIIH and requirement of its DNA helicase subunits, Rad3 and Rad25, in the incision step of nucleotide excision repair.	Sung P, Guzder SN, Prakash L, Prakash S	J Biol Chem May 3, 1996
The nucleotide sequence of Saccharomyces cerevisiae chromosome V.	Dietrich FS, Mulligan J, Hennessy K, Yelton MA, Allen E, Araujo R, Aviles E, Berno A, Brennan T, Carpenter J, Chen E, Cherry JM, Chung E, Duncan M, Guzman E, Hartzell G, Hunicke-Smith S, Hyman RW, Kayser A, Komp C, Lashkari D, Lew H, Lin D, Mosedale D, Davis RW, et al.	Nature May 1, 1997
Global analysis of protein expression in yeast.	Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS	Nature Oct. 16, 2003
Revised subunit structure of yeast transcription factor IIH (TFIIH) and reconciliation with human TFIIH.	Takagi Y, Komori H, Chang WH, Hudmon A, Erdjument-Bromage H, Tempst P, Kornberg RD	J Biol Chem Nov. 7, 2003

Last modification of this entry: Oct. 6, 2010.

Add your own comment!

There is no comment yet.

Welcome stranger! Click here to login or here to register.