|
|
Protein FULL name: 5' to 3' DNA helicase, involved in nucleotide excision repair and transcription; subunit of RNA polymerase II transcription initiation factor TFIIH; subunit of Nucleotide Excision Repair Factor 3 (NEF3); homolog of human XPD protein
Rad3p (Saccharomyces cerevisiae) is product of expression of
RAD3
gene.
Rad3p is involved in:
NER in Saccharomyces cerevisiae
FUNCTION: ATP-dependent DNA helicase involved in excision repair
of DNA damaged with UV light, bulky adducts, or cross-linking
agents. Necessary for excision of pyrimidine dimers. Also unwinds
DNA/RNA duplexes. Plays an essential role in the cell viability.
Involved in the maintenance of the fidelity of DNA replication.
Acts as component of the general transcription and DNA repair
factor IIH (TFIIH) core, which is essential for both basal and
activated transcription, and is involved in nucleotide excision
repair (NER) of damaged DNA. TFIIH has CTD kinase and DNA-
dependent ATPase activity, and is essential for polymerase II
transcription in vitro.
CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.
SUBUNIT: Component of the TFIIH core complex, which is composed of
RAD3, SSL1, SSL2, TFB1, TFB2, TFB4 and TFB5.
INTERACTION:
Q03290:TFB3; NbExp=1; IntAct=EBI-14762, EBI-31406;
SUBCELLULAR LOCATION: Nucleus.
MISCELLANEOUS: Present with 14400 molecules/cell in log phase SD
medium.
SIMILARITY: Belongs to the helicase family. RAD3/XPD subfamily.
SIMILARITY: Contains 1 helicase ATP-binding domain.
This protein can be a part of a given complexes:
Links to other databases:
Protein sequence:
MKFYIDDLPVLFPYPKIYPEQYNYMCDIKKTLDVGGNSILEMPSGTGKTV
SLLSLTIAYQMHYPEHRKIIYCSRTMSEIEKALVELENLMDYRTKELGYQ
EDFRGLGLTSRKNLCLHPEVSKERKGTVVDEKCRRMTNGQAKRKLEEDPE
ANVELCEYHENLYNIEVEDYLPKGVFSFEKLLKYCEEKTLCPYFIVRRMI
SLCNIIIYSYHYLLDPKIAERVSNEVSKDSIVIFDEAHNIDNVCIESLSL
DLTTDALRRATRGANALDERISEVRKVDSQKLQDEYEKLVQGLHSADILT
DQEEPFVETPVLPQDLLTEAIPGNIRRAEHFVSFLKRLIEYLKTRMKVLH
VISETPKSFLQHLKQLTFIERKPLRFCSERLSLLVRTLEVTEVEDFTALK
DIATFATLISTYEEGFLLIIEPYEIENAAVPNPIMRFTCLDASIAIKPVF
ERFSSVIITSGTISPLDMYPRMLNFKTVLQKSYAMTLAKKSFLPMIITKG
SDQVAISSRFEIRNDPSIVRNYGSMLVEFAKITPDGMVVFFPSYLYMESI
VSMWQTMGILDEVWKHKLILVETPDAQETSLALETYRKACSNGRGAILLS
VARGKVSEGIDFDHQYGRTVLMIGIPFQYTESRILKARLEFMRENYRIRE
NDFLSFDAMRHAAQCLGRVLRGKDDYGVMVLADRRFSRKRSQLPKWIAQG
LSDADLNLSTDMAISNTKQFLRTMAQPTDPKDQEGVSVWSYEDLIKHQNS
RKDQGGFIENENKEGEQDEDEDEDIEMQ
|
References:
|
Title
|
Authors
|
Journal
|
|
RAD3 gene of Saccharomyces cerevisiae: nucleotide sequence of wild-type and mutant alleles, transcript mapping, and aspects of gene regulation.
|
Naumovski L, Chu G, Berg P, Friedberg EC
|
Mol Cell Biol
Feb. 1, 1985
|
|
The nucleotide sequence of the RAD3 gene of Saccharomyces cerevisiae: a potential adenine nucleotide binding amino acid sequence and a nonessential acidic carboxyl terminal region.
|
Reynolds P, Higgins DR, Prakash L, Prakash S
|
Nucleic Acids Res
April 11, 1985
|
|
Mutation of lysine-48 to arginine in the yeast RAD3 protein abolishes its ATPase and DNA helicase activities but not the ability to bind ATP.
|
Sung P, Higgins D, Prakash L, Prakash S
|
EMBO J
Oct. 1, 1988
|
|
Effects of multiple yeast rad3 mutant alleles on UV sensitivity, mutability, and mitotic recombination.
|
Song JM, Montelone BA, Siede W, Friedberg EC
|
J Bacteriol
Dec. 1, 1990
|
|
DNA.RNA helicase activity of RAD3 protein of Saccharomyces cerevisiae.
|
Bailly V, Sung P, Prakash L, Prakash S
|
Proc Natl Acad Sci U S A
Nov. 1, 1991
|
|
The RAD3 gene is a member of the DEAH family RNA helicase-like protein.
|
Harosh I, Deschavanne P
|
Nucleic Acids Res
Nov. 25, 1991
|
|
The Rad3 protein from Saccharomyces cerevisiae: a DNA and DNA:RNA helicase with putative RNA helicase activity.
|
Deschavanne PJ, Harosh I
|
Mol Microbiol
March 1, 1993
|
|
Dual roles of a multiprotein complex from S. cerevisiae in transcription and DNA repair.
|
Feaver WJ, Svejstrup JQ, Bardwell L, Bardwell AJ, Buratowski S, Gulyas KD, Donahue TF, Friedberg EC, Kornberg RD
|
Cell
Dec. 31, 1993
|
|
RNA polymerase transcription factor IIH holoenzyme from yeast.
|
Svejstrup JQ, Feaver WJ, LaPointe J, Kornberg RD
|
J Biol Chem
Nov. 11, 1994
|
|
Reconstitution of TFIIH and requirement of its DNA helicase subunits, Rad3 and Rad25, in the incision step of nucleotide excision repair.
|
Sung P, Guzder SN, Prakash L, Prakash S
|
J Biol Chem
May 3, 1996
|
|
The nucleotide sequence of Saccharomyces cerevisiae chromosome V.
|
Dietrich FS, Mulligan J, Hennessy K, Yelton MA, Allen E, Araujo R, Aviles E, Berno A, Brennan T, Carpenter J, Chen E, Cherry JM, Chung E, Duncan M, Guzman E, Hartzell G, Hunicke-Smith S, Hyman RW, Kayser A, Komp C, Lashkari D, Lew H, Lin D, Mosedale D, Davis RW, et al.
|
Nature
May 1, 1997
|
|
Global analysis of protein expression in yeast.
|
Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS
|
Nature
Oct. 16, 2003
|
|
Revised subunit structure of yeast transcription factor IIH (TFIIH) and reconciliation with human TFIIH.
|
Takagi Y, Komori H, Chang WH, Hudmon A, Erdjument-Bromage H, Tempst P, Kornberg RD
|
J Biol Chem
Nov. 7, 2003
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|