Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Dam |
Protein FULL name:
DNA adenine methylase [Escherichia coli str. K-12 substr. MG1655].
Dam (Escherichia coli strain K-12 substr. MG1655) is product of expression of dam gene.
Dam is involved in:
MMR in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Methylates DNA within the sequence GATC and protects the DNA from cleavage by the restriction endonuclease MboI. Although it shares sequence specificity with a number of type II restriction endonucleases and methylases, it is thought to act in postreplication mismatch repair rather than as a part of a restriction modification system. May also play a role in DNA replication.
CATALYTIC ACTIVITY: S-adenosyl-L-methionine + DNA adenine = S- adenosyl-L-homocysteine + DNA 6-methylaminopurine.
SIMILARITY: Belongs to the N(4)/N(6)-methyltransferase family.
| NCBI GenPept GI number(s): |
16131265 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0AEE8 |
P0AEE8 |
| PFAM: | - |
P0AEE8 (Link - using uniprot id) |
| InterPro: | - |
P0AEE8 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKKNRAFLKWAGGKYPLLDDIKRHLPKGECLVEPFVGAGSVFLNTDFSRY ILADINSDLISLYNIVKMRTDEYVQAARELFVPETNCAEVYYQFREEFNK SQDPFRRAVLFLYLNRYGYNGLCRYNLRGEFNVPFGRYKKPYFPEAELYH FAEKAQNAFFYCESYADSMARADDASVVYCDPPYAPLSATANFTAYHTNS FTLEQQAHLAEIAEGLVERHIPVLISNHDTMLTREWYQRAKLHVVKVRRS ISSNGGTRKKVDELLALYKPGVVSPAKK |
References:
| Title | Authors | Journal |
| The isolation and characterization of the Escherichia coli DNA adenine methylase (dam) gene. | Brooks JE, Blumenthal RM, Gingeras TR | Nucleic Acids Res Jan. 11, 1983 |
| The Escherichia coli dam gene is expressed as a distal gene of a new operon. | Jonczyk P, Hines R, Smith DW | Mol Gen Genet May 1, 1989 |
| The role of the preserved sequences of Dam methylase. | Guyot JB, Grassi J, Hahn U, Guschlbauer W | Nucleic Acids Res July 11, 1993 |
| Characterization of three genes in the dam-containing operon of Escherichia coli. | Lyngstadaas A, Lobner-Olesen A, Boye E | Mol Gen Genet June 10, 1995 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|