Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
XseB |
Protein FULL name:
exonuclease VII small subunit [Escherichia coli str. K-12 substr. W3110].
XseB (Escherichia coli strain K-12 substr. MG1655) is product of expression of xseB gene.
FUNCTION: Bidirectionally degrades single-stranded DNA into large acid-insoluble oligonucleotides, which are then degraded further into small acid-soluble oligonucleotides. It can also degrade 3' or 5' ss regions extending from the termini of duplex DNA molecules and displaced ss regions.
CATALYTIC ACTIVITY: Exonucleolytic cleavage in either 5'- to 3'- or 3'- to 5'-direction to yield nucleoside 5'-phosphates.
SUBUNIT: Heterooligomer composed of two different subunits with an approximate ratio of 4 small subunits for 1 large.
SUBCELLULAR LOCATION: Cytoplasm.
SIMILARITY: Belongs to the xseB family.
| NCBI GenPept GI number(s): |
89107292 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A8G9 |
P0A8G9 |
| PFAM: | - |
P0A8G9 (Link - using uniprot id) |
| InterPro: | - |
P0A8G9 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MPKKNEAPASFEKALSELEQIVTRLESGDLPLEEALNEFERGVQLARQGQ AKLQQAEQRVQILLSDNEDASLTPFTPDNE |
Last modification of this entry: Oct. 13, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|