Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
DinG |
Protein FULL name:
ATP-dependent DNA helicase [Escherichia coli str. K-12 substr. W3110].
DinG (Escherichia coli strain K-12 substr. MG1655) is product of expression of dinG gene.
DinG is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Probable helicase involved in DNA repair and perhaps also replication.
CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.
SIMILARITY: Belongs to the helicase family. DinG subfamily.
SIMILARITY: Contains 1 helicase ATP-binding domain.
SEQUENCE CAUTION: Sequence=AAA23685.1; Type=Erroneous initiation;
| NCBI GenPept GI number(s): |
89107650 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P27296 |
P27296 |
| PFAM: | - |
P27296 (Link - using uniprot id) |
| InterPro: | - |
P27296 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MALTAALKAQIAAWYKALQEQIPDFIPRAPQRQMIADVAKTLAGEEGRHL AIEAPTGVGKTLSYLIPGIAIAREEQKTLVVSTANVALQDQIYSKDLPLL KKIIPDLKFTAAFGRGRYVCPRNLTALASTEPTQQDLLAFLDDELTPNNQ EEQKRCAKLKGDLDTYKWDGLRDHTDIAIDDDLWRRLSTDKASCLNRNCY YYRECPFFVARREIQEAEVVVANHALVMAAMESEAVLPDPKNLLLVLDEG HHLPDVARDALEMSAEITAPWYRLQLDLFTKLVATCMEQFRPKTIPPLAI PERLNAHCEELYELIASLNNILNLYMPAGQEAEHRFAMGELPDEVLEICQ RLAKLTEMLRGLAELFLNDLSEKTGSHDIVRLHRLILQMNRALGMFEAQS KLWRLASLAQSSGAPVTKWATREEREGQLHLWFHCVGIRVSDQLERLLWR SIPHIIVTSATLRSLNSFSRLQEMSGLKEKAGDRFVALDSPFNHCEQGKI VIPRMRVEPSIDNEEQHIAEMAAFFRKQVESKKHLGMLVLFASGRAMQRF LDYVTDLRLMLLVQGDQPRYRLVELHRKRVANGERSVLVGLQSFAEGLDL KGDLLSQVHIHKIAFPPIDSPVVITEGEWLKSLNRYPFEVQSLPSASFNL IQQVGRLIRSHGCWGEVVIYDKRLLTKNYGKRLLDALPVFPIEQPEVPEG IVKKKEKTKSPRRRRR |
References:
| Title | Authors | Journal |
| Interaction of LexA repressor with the asymmetric dinG operator and complete nucleotide sequence of the gene. | Lewis LK, Mount DW | J Bacteriol Aug. 1, 1992 |
| Escherichia coli dinG gene encodes a putative DNA helicase related to a group of eukaryotic helicases including Rad3 protein. | Koonin EV | Nucleic Acids Res March 25, 1993 |
| Structural analysis of the rhlE gene of Escherichia coli. | Ohmori H | Jpn J Genet Jan. 1, 1994 |
| A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. | Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. | DNA Res June 1, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|