|
Protein FULL name: DNA damage-inducible protein I [Escherichia coli str. K-12 substr. W3110].
DinI (Escherichia coli strain K-12 substr. MG1655) is product of expression of
dinI
gene.
DinI is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Involved in SOS regulation. Inhibits recA by preventing
recA to bind ssDNA. Can displace ssDNA from recA.
SIMILARITY: Belongs to the dinI family.
SEQUENCE CAUTION:
Sequence=BAA35858.1; Type=Erroneous initiation;
Links to other databases:
Protein sequence:
MRIEVTIAKTSPLPAGAIDALAGELSRRIQYAFPDNEGHVSVRYAAANNL
SVIGATKEDKQRISEILQETWESADDWFVSE
|
References:
Title
|
Authors
|
Journal
|
A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map.
|
Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al.
|
DNA Res
June 1, 1996
|
Multicopy suppressors of the cold-sensitive phenotype of the pcsA68 (dinD68) mutation in Escherichia coli.
|
Yasuda T, Nagata T, Ohmori H
|
J Bacteriol
July 1, 1996
|
The complete genome sequence of Escherichia coli K-12.
|
Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y
|
Science
Sept. 5, 1997
|
Solution structure of DinI provides insight into its mode of RecA inactivation.
|
Ramirez BE, Voloshin ON, Camerini-Otero RD, Bax A
|
Protein Sci
Nov. 1, 2000
|
A model for the abrogation of the SOS response by an SOS protein: a negatively charged helix in DinI mimics DNA in its interaction with RecA.
|
Voloshin ON, Ramirez BE, Bax A, Camerini-Otero RD
|
Genes Dev
Jan. 15, 2001
|
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
|
Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T
|
Mol Syst Biol
Jan. 1, 2006
|
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|