Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
DinI |
Protein FULL name:
DNA damage-inducible protein I [Escherichia coli str. K-12 substr. W3110].
DinI (Escherichia coli strain K-12 substr. MG1655) is product of expression of dinI gene.
DinI is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Involved in SOS regulation. Inhibits recA by preventing recA to bind ssDNA. Can displace ssDNA from recA.
SIMILARITY: Belongs to the dinI family.
SEQUENCE CAUTION: Sequence=BAA35858.1; Type=Erroneous initiation;
| NCBI GenPept GI number(s): |
89107907 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0ABR1 |
P0ABR1 |
| PFAM: | - |
P0ABR1 (Link - using uniprot id) |
| InterPro: | - |
P0ABR1 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MRIEVTIAKTSPLPAGAIDALAGELSRRIQYAFPDNEGHVSVRYAAANNL SVIGATKEDKQRISEILQETWESADDWFVSE |
References:
| Title | Authors | Journal |
| A 718-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 12.7-28.0 min region on the linkage map. | Oshima T, Aiba H, Baba T, Fujita K, Hayashi K, Honjo A, Ikemoto K, Inada T, Itoh T, Kajihara M, Kanai K, Kashimoto K, Kimura S, Kitagawa M, Makino K, Masuda S, Miki T, Mizobuchi K, Mori H, Motomura K, Nakamura Y, Nashimoto H, Nishio Y, Saito N, Horiuchi T, et al. | DNA Res June 1, 1996 |
| Multicopy suppressors of the cold-sensitive phenotype of the pcsA68 (dinD68) mutation in Escherichia coli. | Yasuda T, Nagata T, Ohmori H | J Bacteriol July 1, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Solution structure of DinI provides insight into its mode of RecA inactivation. | Ramirez BE, Voloshin ON, Camerini-Otero RD, Bax A | Protein Sci Nov. 1, 2000 |
| A model for the abrogation of the SOS response by an SOS protein: a negatively charged helix in DinI mimics DNA in its interaction with RecA. | Voloshin ON, Ramirez BE, Bax A, Camerini-Otero RD | Genes Dev Jan. 15, 2001 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 12, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|