Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Dpb3p |
Dpb3p is involved in:
MMR in Saccharomyces cerevisiae
- DNA polymerase 3 resynthesizes DNA (5' directed MMR, proximal site) in Saccharomyces cerevisiae
- DNA polymerase 3 resynthesizes DNA (3' directed MMR) in Saccharomyces cerevisiae
Keywords:
- mismatch repair (MMR)
- transcription-coupled repair NER (TCR-NER)
- nucleotide excision repair (NER)
- base excision repair (BER)
- homologous recombination repair (HRR)
- global genome repair NER (GGR-NER)
FUNCTION: DNA polymerase epsilon (DNA polymerase II) participates in chromosomal DNA replication. It is required during synthesis of the leading and lagging DNA strands at the replication fork and binds at/or near replication origins and moves along DNA with the replication fork. It has 3'-5' proofreading exonuclease activity that correct errors arising during DNA replication. It is also involved in DNA synthesis during DNA repair.
CATALYTIC ACTIVITY: Deoxynucleoside triphosphate + DNA(n) = diphosphate + DNA(n+1).
SUBUNIT: DNA polymerase epsilon is a heterotetramer consisting of POL2, DPB2, DPB3 and DPB4.
INTERACTION: P36156:ECM4; NbExp=1; IntAct=EBI-6076, EBI-2042717;
SUBCELLULAR LOCATION: Nucleus.
MISCELLANEOUS: In eukaryotes there are five DNA polymerases: alpha, beta, gamma, delta, and epsilon which are responsible for different reactions of DNA synthesis.
MISCELLANEOUS: Present with 784 molecules/cell in log phase SD medium.
| NCBI GenPept GI number(s): |
429123 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P27344 |
P27344 |
| PFAM: | - |
P27344 (Link - using uniprot id) |
| InterPro: |
IPR009072 |
IPR009072 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSNLVKEKAPVFPISKVKKIAKCDPEYVITSNVAISATAFAAELFVQNLV EESLVLAQLNSKGKTSLRLSLNSIEECVEKRDNFRFLEDAIKQLKKNSAL DKKRELNMQPGRSDQEVVIEEPELHEDDGVEEEEEEDEVSEEEEPVHNEE LLDDSKDQQNDKSTRSVASLLSRFQYKSALDVGEHSDSSDIEVDHTKSTD P |
Dpb3p (Saccharomyces cerevisiae) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Cloning DPB3, the gene encoding the third subunit of DNA polymerase II of Saccharomyces cerevisiae. | Araki H, Hamatake RK, Morrison A, Johnson AL, Johnston LH, Sugino A | Nucleic Acids Res Sept. 25, 1991 |
| The sequence of a 32,420 bp segment located on the right arm of chromosome II from Saccharomyces cerevisiae. | Holmstrom K, Brandt T, Kallesoe T | Yeast April 1, 1994 |
| Complete DNA sequence of yeast chromosome II. | Feldmann H, Aigle M, Aljinovic G, Andre B, Baclet MC, Barthe C, Baur A, Becam AM, Biteau N, Boles E, et al. | EMBO J Dec. 15, 1994 |
| Structure and function of the fourth subunit (Dpb4p) of DNA polymerase epsilon in Saccharomyces cerevisiae. | Ohya T, Maki S, Kawasaki Y, Sugino A | Nucleic Acids Res Oct. 15, 2000 |
| Fidelity of DNA polymerase epsilon holoenzyme from budding yeast Saccharomyces cerevisiae. | Shimizu K, Hashimoto K, Kirchner JM, Nakai W, Nishikawa H, Resnick MA, Sugino A | J Biol Chem Oct. 4, 2002 |
| The quaternary structure of DNA polymerase epsilon from Saccharomyces cerevisiae. | Chilkova O, Jonsson BH, Johansson E | J Biol Chem April 18, 2003 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry. | Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF | Proc Natl Acad Sci U S A Jan. 13, 2007 |
| Large-scale phosphorylation analysis of alpha-factor-arrested Saccharomyces cerevisiae. | Li X, Gerber SA, Rudner AD, Beausoleil SA, Haas W, Villen J, Elias JE, Gygi SP | J Proteome Res March 1, 2007 |
| Proteome-wide identification of in vivo targets of DNA damage checkpoint kinases. | Smolka MB, Albuquerque CP, Chen SH, Zhou H | Proc Natl Acad Sci U S A June 19, 2007 |
| A multidimensional chromatography technology for in-depth phosphoproteome analysis. | Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H | Mol Cell Proteomics July 1, 2008 |
Last modification of this entry: Oct. 19, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|