Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Phr1p |
Protein FULL name:
CPD photolyase, DNA photolyase
Phr1p (Saccharomyces cerevisiae) is product of expression of PHR1 gene.
Keywords:
FUNCTION: Involved in repair of UV radiation-induced DNA damage. Catalyzes the light-dependent monomerization (300-600 nm) of cyclobutyl pyrimidine dimers (in cis-syn configuration), which are formed between adjacent bases on the same DNA strand upon exposure to ultraviolet radiation.
CATALYTIC ACTIVITY: Cyclobutadipyrimidine (in DNA) = 2 pyrimidine residues (in DNA).
COFACTOR: Binds 1 FAD per subunit.
COFACTOR: Binds 1 5,10-methenyltetrahydrofolate non-covalently per subunit.
BIOPHYSICOCHEMICAL PROPERTIES: Absorption: Abs(max)=377 nm; Note=Has a fluorescence excitation maximum at 390 nm and an emission maximum at 475 nm;
SUBUNIT: Monomer (By similarity).
INTERACTION: P15179:MSD1; NbExp=1; IntAct=EBI-13385, EBI-18659; P33203:PRP40; NbExp=1; IntAct=EBI-13385, EBI-701;
SUBCELLULAR LOCATION: Nucleus. Mitochondrion.
MISCELLANEOUS: There are only 150-300 molecules of photolyase per yeast cell.
MISCELLANEOUS: Present with 688 molecules/cell in log phase SD medium.
SIMILARITY: Belongs to the DNA photolyase class-1 family.
SIMILARITY: Contains 1 DNA photolyase domain.
| NCBI GenPept GI number(s): |
1420831 |
| Species: | Saccharomyces cerevisiae |
Links to other databases:
| Database | ID | Link |
| Uniprot | P05066 |
P05066 |
| PFAM: | - |
P05066 (Link - using uniprot id) |
| InterPro: |
IPR002081 IPR005101 IPR006050 IPR006051 |
IPR002081 IPR005101 IPR006050 IPR006051 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKRTVISSSNAYASKRSRLDIEHDFEQYHSLNKKYYPRPITRTGANQFNN KSRAKPMEIVEKLQKKQKTSFENVSTVMHWFRNDLRLYDNVGLYKSVALF QQLRQKNAKAKLYAVYVINEDDWRAHMDSGWKLMFIMGALKNLQQSLAEL HIPLLLWEFHTPKSTLSNSKEFVEFFKEKCMNVSSGTGTIITANIEYQTD ELYRDIRLLENEDHRLQLKYYHDSCIVAPGLITTDRGTNYSVFTPWYKKW VLYVNNYKKSTSEICHLHIIEPLKYNETFELKPFQYSLPDEFLQYIPKSK WCLPDVSEEAALSRLKDFLGTKSSKYNNEKDMLYLGGTSGLSVYITTGRI STRLIVNQAFQSCNGQIMSKALKDNSSTQNFIKEVAWRDFYRHCMCNWPY TSMGMPYRLDTLDIKWENNPVAFEKWCTGNTGIPIVDAIMRKLLYTGYIN NRSRMITASFLSKNLLIDWRWGERWFMKHLIDGDSSSNVGGWGFCSSTGI DAQPYFRVFNMDIQAKKYDPQMIFVKQWVPELISSENKRPENYPKPLVDL KHSRERALKVYKDAM |
Phr1p (Saccharomyces cerevisiae) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Homology between the photoreactivation genes of Saccharomyces cerevisiae and Escherichia coli. | Yasui A, Langeveld SA | Gene Jan. 1, 1985 |
| Sequence of the Saccharomyces cerevisiae PHR1 gene and homology of the PHR1 photolyase to E. coli photolyase. | Sancar GB | Nucleic Acids Res Nov. 25, 1985 |
| Purification of the yeast PHR1 photolyase from an Escherichia coli overproducing strain and characterization of the intrinsic chromophores of the enzyme. | Sancar GB, Smith FW, Heelis PF | J Biol Chem Nov. 15, 1987 |
| The role of conserved amino acids in substrate binding and discrimination by photolyase. | Baer ME, Sancar GB | J Biol Chem Aug. 5, 1993 |
| The nucleotide sequence of Saccharomyces cerevisiae chromosome XV. | Dujon B, Albermann K, Aldea M, Alexandraki D, Ansorge W, Arino J, Benes V, Bohn C, Bolotin-Fukuhara M, Bordonne R, Boyer J, Camasses A, Casamayor A, Casas C, Cheret G, Cziepluch C, Daignan-Fornier B, Dang DV, de Haan M, Delius H, Durand P, Fairhead C, Feldmann H, Gaillon L, Kleine K, et al. | Nature May 1, 1997 |
| Global analysis of protein expression in yeast. | Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS | Nature Oct. 16, 2003 |
| Light-driven enzymatic catalysis of DNA repair: a review of recent biophysical studies on photolyase. | Weber S | Biochim Biophys Acta Jan. 25, 2005 |
Last modification of this entry: Nov. 14, 2020.
Add your own comment!
There is no comment yet.
|
|
|
|