|
|
Pol32p (Saccharomyces cerevisiae) is product of expression of
POL32
gene.
Keywords:
FUNCTION: DNA polymerase delta (DNA polymerase III) participates
in chromosomal DNA replication. It is required during synthesis of
the leading and lagging DNA strands at the replication fork and
binds at/or near replication origins and moves along DNA with the
replication fork. It has 3'-5' proofreading exonuclease activity
that correct errors arising during DNA replication. It is also
involved in DNA synthesis during DNA repair.
SUBUNIT: DNA polymerase delta is a heterotrimer of POL3, POL32 and
HYS2. POL32 can form homodimers.
INTERACTION:
Q03392:pcn1 (xeno); NbExp=1; IntAct=EBI-6084, EBI-768724;
SUBCELLULAR LOCATION: Nucleus (By similarity).
MISCELLANEOUS: Present with 2410 molecules/cell in log phase SD
medium.
Links to other databases:
Protein sequence:
MDQKASYFINEKLFTEVKPVLFTDLIHHLKIGPSMAKKLMFDYYKQTTNA
KYNCVVICCYKDQTIKIIHDLSNIPQQDSIIDCFIYAFNPMDSFIPYYDI
IDQKDCLTIKNSYELKVSESSKIIERTKTLEEKSKPLVRPTARSKTTPEE
TTGRKSKSKDMGLRSTALLAKMKKDRDDKETSRQNELRKRKEENLQKINK
QNPEREAQMKELNNLFVEDDLDTEEVNGGSKPNSPKETDSNDKDKNNDDL
EDLLETTAEDSLMDVPKIQQTKPSETEHSKEPKSEEEPSSFIDEDGYIVT
KRPATSTPPRKPSPVVKRALSSSKKQETPSSNKRLKKQGTLESFFKRKAK
|
Pol32p (Saccharomyces cerevisiae) is able to recognize following damages:
References:
|
Title
|
Authors
|
Journal
|
|
Analysis of a 42.5 kb DNA sequence of chromosome X reveals three tRNA genes and 14 new open reading frames including a gene most probably belonging to the family of ubiquitin-protein ligases.
|
Huang ME, Chuat JC, Galibert F
|
Yeast
June 1, 1995
|
|
Complete nucleotide sequence of Saccharomyces cerevisiae chromosome X.
|
Galibert F, Alexandraki D, Baur A, Boles E, Chalwatzis N, Chuat JC, Coster F, Cziepluch C, De Haan M, Domdey H, Durand P, Entian KD, Gatius M, Goffeau A, Grivell LA, Hennemann A, Herbert CJ, Heumann K, Hilger F, Hollenberg CP, Huang ME, Jacq C, Jauniaux JC, Katsoulou C, Karpfinger-Hartl L, et al.
|
EMBO J
May 1, 1996
|
|
Characterization of the two small subunits of Saccharomyces cerevisiae DNA polymerase delta.
|
Gerik KJ, Li X, Pautz A, Burgers PM
|
J Biol Chem
July 31, 1998
|
|
Structure of DNA polymerase delta from Saccharomyces cerevisiae.
|
Johansson E, Majka J, Burgers PM
|
J Biol Chem
Nov. 23, 2001
|
|
Global analysis of protein expression in yeast.
|
Ghaemmaghami S, Huh WK, Bower K, Howson RW, Belle A, Dephoure N, O'Shea EK, Weissman JS
|
Nature
Oct. 16, 2003
|
|
Analysis of phosphorylation sites on proteins from Saccharomyces cerevisiae by electron transfer dissociation (ETD) mass spectrometry.
|
Chi A, Huttenhower C, Geer LY, Coon JJ, Syka JE, Bai DL, Shabanowitz J, Burke DJ, Troyanskaya OG, Hunt DF
|
Proc Natl Acad Sci U S A
Jan. 13, 2007
|
|
Approaching a complete repository of sequence-verified protein-encoding clones for Saccharomyces cerevisiae.
|
Hu Y, Rolfs A, Bhullar B, Murthy TV, Zhu C, Berger MF, Camargo AA, Kelley F, McCarron S, Jepson D, Richardson A, Raphael J, Moreira D, Taycher E, Zuo D, Mohr S, Kane MF, Williamson J, Simpson A, Bulyk ML, Harlow E, Marsischky G, Kolodner RD, LaBaer J
|
Genome Res
April 1, 2007
|
|
A multidimensional chromatography technology for in-depth phosphoproteome analysis.
|
Albuquerque CP, Smolka MB, Payne SH, Bafna V, Eng J, Zhou H
|
Mol Cell Proteomics
July 1, 2008
|
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|