Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RAD50 |
Protein FULL name:
RAD50; ATP binding / nuclease/ zinc ion binding [Arabidopsis thaliana].
RAD50 (Arabidopsis thaliana) is product of expression of RAD50 gene.
FUNCTION: Implicated in double-strand breaks (DSBs) repair by non- homologous end joining (NHEJ). Involved in telomere maintenance. Involved in telomerase action on chromosome ends. Required during meiosis for both male and female gametophytic development, for pairing and synapsis of homologous chromosomes during the early stages of meiotic recombination, especially during the pachytene stage of the first division.
COFACTOR: Binds 1 zinc ion per homodimer (By similarity).
SUBUNIT: Homodimer (By similarity). Interacts with AtMRE11.
SUBCELLULAR LOCATION: Nucleus (Probable). Telomere (Probable).
TISSUE SPECIFICITY: Widely expressed, predominantly in meristematic and reproductive tissues.
DOMAIN: The zinc-hook, which separates the large intramolecular coiled coil regions, contains 2 Cys residues that coordinate one molecule of zinc with the help of the 2 Cys residues of the zinc- hook of another RAD50 molecule, thereby forming a V-shaped homodimer. The two heads of the homodimer, which constitute the ATP-binding domain, interact with the MRE11A homodimer (By similarity).
SIMILARITY: Belongs to the SMC family. RAD50 subfamily.
SIMILARITY: Contains 1 zinc-hook domain.
| NCBI GenPept GI number(s): |
18402837 |
| Species: | Arabidopsis thaliana |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q9SL02 |
Q9SL02 |
| PFAM: | - |
Q9SL02 (Link - using uniprot id) |
| InterPro: |
InterPro DOMAIN/s: Zinc hook Rad50 (IPR013134) Rad50 zinc hook (IPR007517) N-terminal (IPR003395) Recombination/repair protein Rad50 (IPR004584); |
InterPro DOMAIN/s: Zinc hook Rad50 (IPR013134) Rad50 zinc hook (IPR007517) N-terminal (IPR003395) Recombination/repair protein Rad50 (IPR004584); |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSTVDKMLIKGIRSFDPENKNVVTFFRPLTLIVGANGAGKTTIIECLKVS CTGELPPNARSGHSFIHDPKVAGETETKAQIKLRFKTAAGKDVVCIRSFQ LTQKASKMEYKAIESVLQTINPHTGEKVCLSYRCADMDREIPALMGVSKA ILENVIFVHQDESNWPLQDPSTLKKKFDDIFSATRYTKALEVIKKLHKDQ AQEIKTFKLKLENLQTLKDAAYKLRESIAQDQERTESSKVQMLELETSVQ KVDAEVHNKEMMLKDLRKLQDQVSIKTAERSTLFKEQQRQYAALPEENED TIEELKEWKSKFEERLALLGTKIRKMEREMVDTETTISSLHNAKTNYMLE ISKLQTEAEAHMLLKNERDSTIQNIFFHYNLGNVPSTPFSTEVVLNLTNR IKSRLGELEMDLLDKKKSNETALSTAWDCYMDANDRWKSIEAQKRAKDEI KMGISKRIEEKEIERDSFEFEISTVDVKQTDEREKQVQVELERKTKQNSE RGFESKIEQKQHEIYSLEHKIKTLNRERDVMAGDAEDRVKLSLKKTEQEN LKKKHKKIIDECKDRIRGVLKGRLPPEKDMKREIVQALRSIEREYDDLSL KSREAEKEVNMLQMKIQEVNNSLFKHNKDTESRKRYIESKLQALKQESVT IDAYPKLLESAKDKRDDRKREYNMANGMRQMFEPFEKRARQEHSCPCCER SFTADEEASFIKKQRVKASSTGEHLKALAVESSNADSVFQQLDKLRAVFE EYSKLTTEIIPLAEKTLQEHTEELGQKSEALDDVLGISAQIKADKDSIEA LVQPLENADRIFQEIVSYQKQIEDLEYKLDFRGLGVKTMEEIQSELSSLQ SSKDKLHGELEKLRDDQIYMERDISCLQARWHAVREEKAKAANLLRDVTK AEEDLERLAEEKSQLDLDVKYLTEALGPLSKEKEQLLSDYNDMKIRRNQE YEELAEKKRNYQQEVEALLKASYKINEYHDLKKGERLDDIQEKQRLSDSQ LQSCEARKNELAGELNRNKDLMRNQDQLRRNIEDNLNYRTTKAKVEELTR EIESLEEQILNIGGIAAVEAEIVKILRERERLLSELNRCRGTVSVYESSI SKNRVELKQAQYKDIDKRHFDQLIQLKTTEMANKDLDRYYNALDKALMRF HTMKMEEINKIIRELWQQTYRGQDMDYIRIHSDSEGAGTRSYSYKVLMQT GDTELEMRGRCSAGQKVLASLIIRLALAETFCLNCGILALDEPTTNLDGP NSESLAGALLRIMEDRKGQENFQLIVITHDERFAQMIGQRQHAEKYYRVA KDDMQHSIIEAQEIFD |
RAD50 (Arabidopsis thaliana) is able to recognize following damages:
References:
| Title | Authors | Journal |
| Sequence and analysis of chromosome 2 of the plant Arabidopsis thaliana. | Lin X, Kaul S, Rounsley S, Shea TP, Benito MI, Town CD, Fujii CY, Mason T, Bowman CL, Barnstead M, Feldblyum TV, Buell CR, Ketchum KA, Lee J, Ronning CM, Koo HL, Moffat KS, Cronin LA, Shen M, Pai G, Van Aken S, Umayam L, Tallon LJ, Gill JE, Adams MD, Carrera AJ, Creasy TH, Goodman HM, Somerville CR, Copenhaver GP, Preuss D, Nierman WC, White O, Eisen JA, Salzberg SL, Fraser CM, Venter JC | Nature Dec. 16, 1999 |
| RAD50 function is essential for telomere maintenance in Arabidopsis. | Gallego ME, White CI | Proc Natl Acad Sci U S A Jan. 13, 2001 |
| Disruption of the Arabidopsis RAD50 gene leads to plant sterility and MMS sensitivity. | Gallego ME, Jeanneau M, Granier F, Bouchez D, Bechtold N, White CI | Plant J Feb. 1, 2001 |
| Homologous recombination in planta is stimulated in the absence of Rad50. | Gherbi H, Gallego ME, Jalut N, Lucht JM, Hohn B, White CI | EMBO Rep April 1, 2001 |
| The plant Rad50-Mre11 protein complex. | Daoudal-Cotterell S, Gallego ME, White CI | FEBS Lett April 10, 2002 |
| Empirical analysis of transcriptional activity in the Arabidopsis genome. | Yamada K, Lim J, Dale JM, Chen H, Shinn P, Palm CJ, Southwick AM, Wu HC, Kim C, Nguyen M, Pham P, Cheuk R, Karlin-Newmann G, Liu SX, Lam B, Sakano H, Wu T, Yu G, Miranda M, Quach HL, Tripp M, Chang CH, Lee JM, Toriumi M, Chan MM, Tang CC, Onodera CS, Deng JM, Akiyama K, Ansari Y, Arakawa T, Banh J, Banno F, Bowser L, Brooks S, Carninci P, Chao Q, Choy N, Enju A, Goldsmith AD, Gurjal M, Hansen NF, Hayashizaki Y, Johnson-Hopson C, Hsuan VW, Iida K, Karnes M, Khan S, Koesema E, Ishida J, Jiang PX, Jones T, Kawai J, Kamiya A, Meyers C, Nakajima M, Narusaka M, Seki M, Sakurai T, Satou M, Tamse R, Vaysberg M, Wallender EK, Wong C, Yamamura Y, Yuan S, Shinozaki K, Davis RW, Theologis A, Ecker JR | Science Oct. 31, 2003 |
| Meiotic defects in the Arabidopsis rad50 mutant point to conservation of the MRX complex function in early stages of meiotic recombination. | Bleuyard JY, Gallego ME, White CI | Chromosoma Oct. 1, 2004 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|