Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RecA |
Protein FULL name:
RecA [Escherichia coli].
RecA (Escherichia coli strain K-12 substr. MG1655) is product of expression of recA gene.
RecA is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
- DNA polymerase III takes part in a strand invasion in Escherichia coli strain K-12 substr. MG1655
- RecA joins and starts the filament formation in Escherichia coli strain K-12 substr. MG1655
- RecA and RecFOR join and start the filament formation in Escherichia coli strain K-12 substr. MG1655
- DNA polymerase I takes part in a strand invasion and DNA synthesis in Escherichia coli strain K-12 substr. MG1655
FUNCTION: Can catalyze the hydrolysis of ATP in the presence of single-stranded DNA, the ATP-dependent uptake of single-stranded DNA by duplex DNA, and the ATP-dependent hybridization of homologous single-stranded DNAs. It interacts with lexA causing its activation and leading to its autocatalytic cleavage.
SUBCELLULAR LOCATION: Cytoplasm.
INDUCTION: In response to low temperature. Sensitive to temperature through changes in the linking number of the DNA.
SIMILARITY: Belongs to the recA family.
| NCBI GenPept GI number(s): |
37362719 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A7G6 |
P0A7G6 |
| PFAM: | - |
P0A7G6 (Link - using uniprot id) |
| InterPro: | - |
P0A7G6 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
ARKLGVDIDNLLCSQPDTGEQALEICDALARSGAVDVIVVDSVAALTPKA EIEGEIGDSHMGLAARMMSQAMRKLAGNLKQSNTLLIFINQIRMKIGVMF GNPETTTGGNALKFYASVRLDIRRIGAVKEGENVVGSETRVKVVKNKIAA PFKQAEFQILYGEGINFYG |
References:
| Title | Authors | Journal |
| Organization of the recA gene of Escherichia coli. | Horii T, Ogawa T, Ogawa H | Proc Natl Acad Sci U S A Feb. 1, 1980 |
| Sequences of the recA gene and protein. | Sancar A, Stachelek C, Konigsberg W, Rupp WD | Proc Natl Acad Sci U S A May 1, 1980 |
| DNA sequence analysis of the recA genes from Proteus vulgaris, Erwinia carotovora, Shigella flexneri and Escherichia coli B/r. | Zhao XJ, McEntee K | Mol Gen Genet July 1, 1990 |
| The structure of the E. coli recA protein monomer and polymer. | Story RM, Weber IT, Steitz TA | Nature Feb. 23, 1992 |
| Structure of the recA protein-ADP complex. | Story RM, Steitz TA | Nature Feb. 23, 1992 |
| The DNA-binding site of the RecA protein. Photochemical cross-linking of Tyr103 to single-stranded DNA. | Morimatsu K, Horii T | Eur J Biochem March 15, 1995 |
| The identification of the single-stranded DNA-binding domain of the Escherichia coli RecA protein. | Gardner RV, Voloshin ON, Camerini-Otero RD | Eur J Biochem Oct. 15, 1995 |
| The RecA hexamer is a structural homologue of ring helicases. | Yu X, Egelman EH | Nat Struct Biol Jan. 1, 1997 |
| Construction of a contiguous 874-kb sequence of the Escherichia coli -K12 genome corresponding to 50.0-68.8 min on the linkage map and analysis of its sequence features. | Yamamoto Y, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kimura S, Kitagawa M, Makino K, Miki T, Mitsuhashi N, Mizobuchi K, Mori H, Nakade S, Nakamura Y, Nashimoto H, Oshima T, Oyama S, Saito N, Sampei G, Satoh Y, Sivasundaram S, Tagami H, Horiuchi T, et al. | DNA Res April 28, 1997 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|