Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RecE |
Protein FULL name:
recE [Escherichia coli].
RecE (Escherichia coli strain K-12 substr. MG1655) is product of expression of recE gene.
FUNCTION: Is involved in the recE pathway of recombination. Has a strong preference for linear duplex substrate DNA and appears to be unable to initiate degradation from single-stranded breaks in DNA.
CATALYTIC ACTIVITY: Degradation of double-stranded DNA. It acts progressively in a 5' to 3' direction, releasing 5'- phosphomononucleotides.
SUBUNIT: Homotetramer.
| NCBI GenPept GI number(s): |
147536 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P15032 |
P15032 |
| PFAM: | - |
P15032 (Link - using uniprot id) |
| InterPro: | - |
P15032 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MSTKPLFLLRKAKKSSGEPDVVLWASNDFESTCATLDYLIVKSGKKLSSY FKAVATNFPVVNDLPAEGEIDFTWSERYQLSKDSMTWELKPGAAPDNAHY QGNTNVNGEDMTEIEENMLLPISGQELPIRWLAQHGSEKPVTHVSRDGLQ ALHIARAEELPAVTALAVSHKTSLLDPLEIRELHKLVRDTDKVFPNPGNS NLGLITAFFEAYLNADYTDRGLLTKEWMKGNRVSHITRTASGANAGGGNL TDRGEGFVHDLTSLARDVATGVLARSMDLDIYNLHPAHAKRIEEIIAENK PPFSVFRDKFITMPGGLDYSRAIVVASVKEAPIGIEVIPAHVTEYLNKVL TETDHANPDPEIVDIGCGRSSAPMPQRVTEEGKQDDEEKPQPSGTTAVEQ GEAETMEPDATEHHQDTQPLDAQSQVNSVDAKYQELRAELHEARKNIPSK NPVDDDKLLAASRGEFVDGISDPNDPKWVKGIQTRDCVYQNQPETEKTSP DMNQPEPVVQQEPEIACNACGQTGGDNCPDCGAVMGDATYQETFDEESQV EAKENDPEEMEGAEHPHNENAGSDPHRDCSDETGEVADPVIVEDIEPGIY YGISNENYHAGPGISKSQLDDIADTPALYLWRKNAPVDTTKTKTLDLGTA FHCRVLEPEEF |
References:
| Title | Authors | Journal |
| Suppression of a frameshift mutation in the recE gene of Escherichia coli K-12 occurs by gene fusion. | Chu CC, Templin A, Clark AJ | J Bacteriol April 1, 1989 |
| Physical analysis of spontaneous and mutagen-induced mutants of Escherichia coli K-12 expressing DNA exonuclease VIII activity. | Mahajan SK, Chu CC, Willis DK, Templin A, Clark AJ | Genetics June 1, 1990 |
| Genetic and molecular analyses of the C-terminal region of the recE gene from the Rac prophage of Escherichia coli K-12 reveal the recT gene. | Clark AJ, Sharma V, Brenowitz S, Chu CC, Sandler S, Satin L, Templin A, Berger I, Cohen A | J Bacteriol Dec. 1, 1993 |
| A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map. | Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al. | DNA Res Dec. 31, 1996 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|