|
|
Protein FULL name: RecF [Escherichia coli].
RecF (Escherichia coli strain K-12 substr. MG1655) is product of expression of
recF
gene.
RecF is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
FUNCTION: The recF protein is involved in DNA metabolism; it is
required for DNA replication and normal SOS inducibility. RecF
binds preferentially to single-stranded, linear DNA. It also seems
to bind ATP.
INTERACTION:
P0A6F5:groL; NbExp=1; IntAct=EBI-556839, EBI-543750;
SUBCELLULAR LOCATION: Cytoplasm (By similarity).
SIMILARITY: Belongs to the recF family.
Links to other databases:
Protein sequence:
MSLTRLLIRDFRNIETADLALSPGFNFLVGANGSGKTSVLEAIYTLGHGR
AFRSLQIGRVIRHEQEAFVLHGRLQGEERETAIGLTKDKQGDSKVRIDGT
DGHKVAELAHLMPMQLITPEGFTLLNGGPKYRRAFLDWGCFHNEPGFFTA
WSNLKRLLKQRNAALRQVTRYEQLRPWDKELIPLAEQISTWRAEYSAGIA
ADMADTCKQFLPEFSLTFSFQRGWEKETEYAEVLERNFERDRQLTYTAHG
PHKADLRIRADGAPVEDTLSRGQLKLLMCALRLAQGEFLTRESGRRCLYL
IDDFASELDDERRGLLASRLKATQSQVFVSAISAEHVIDMSDENSKMFTV
EKGKITD
|
References:
|
Title
|
Authors
|
Journal
|
|
Molecular analysis of the recF gene of Escherichia coli.
|
Blanar MA, Sandler SJ, Armengod ME, Ream LW, Clark AJ
|
Proc Natl Acad Sci U S A
Aug. 1, 1984
|
|
DNA sequence and transcription of the region upstream of the E. coli gyrB gene.
|
Adachi T, Mizuuchi K, Menzel R, Gellert M
|
Nucleic Acids Res
Aug. 24, 1984
|
|
Purification and preliminary characterization of the Escherichia coli K-12 recF protein.
|
Griffin TJ 4th, Kolodner RD
|
J Bacteriol
Nov. 1, 1990
|
|
Sequence and complementation analysis of recF genes from Escherichia coli, Salmonella typhimurium, Pseudomonas putida and Bacillus subtilis: evidence for an essential phosphate binding loop.
|
Sandler SJ, Chackerian B, Li JT, Clark AJ
|
Nucleic Acids Res
Jan. 25, 1992
|
|
DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication.
|
Burland V, Plunkett G 3rd, Daniels DL, Blattner FR
|
Genomics
June 1, 1993
|
|
The complete genome sequence of Escherichia coli K-12.
|
Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y
|
Science
Sept. 5, 1997
|
|
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
|
Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T
|
Mol Syst Biol
Jan. 1, 2006
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|