Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RecG |
Protein FULL name:
recG [Escherichia coli].
RecG (Escherichia coli strain K-12 substr. MG1655) is product of expression of recG gene.
RecG is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
- Replication restart (from RuvABC branch migration) in Escherichia coli strain K-12 substr. MG1655
- RecG restorates two intact helices in RecFOR pathway in Escherichia coli strain K-12 substr. MG1655
- RecG starts branch migration and resolution of Holliday junction in RecFOR pathway in Escherichia coli strain K-12 substr. MG1655
- RecG starts branch migration and resolution of Holliday junction in Escherichia coli strain K-12 substr. MG1655
FUNCTION: Critical role in recombination and DNA repair. Help process Holliday junction intermediates to mature products by catalyzing branch migration. Has a DNA unwinding activity characteristic of a DNA helicase with a 3' to 5' polarity. recG unwind branched duplex DNA (Y-DNA). Has a role in constitutive stable DNA replication (csdR) and R-loop formation.
CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.
INTERACTION: P06959:aceF; NbExp=1; IntAct=EBI-556882, EBI-542707;
SIMILARITY: Belongs to the helicase family. RecG subfamily.
SIMILARITY: Contains 1 helicase ATP-binding domain.
SIMILARITY: Contains 1 helicase C-terminal domain.
| NCBI GenPept GI number(s): |
42669 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P24230 |
P24230 |
| PFAM: | - |
P24230 (Link - using uniprot id) |
| InterPro: |
IPR001650 IPR004365 IPR004609 IPR008994 IPR011545 |
IPR001650 IPR004365 IPR004609 IPR008994 IPR011545 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MKGRLLDAVPLSSLTGVGAALSNKLAKINLHTVQDLLLHLPLRYEDRTHL YPIGELLPGVYATVEGEVLNCNISFGGRRMMTCQISDGSGILTMRFFNFS AAMKNSLAAGRRVLAYGEAKRGKYGAEMIHPEYRVQGDLSTPELQETLTP VYPTTEGVKQATLRKLTDQALDLLDTCAIEELLPPELSQGMMTLPEALRT LHRPPPTLQLSDLETGQHPAQRRLILEELLAHNLSMLALRAGAQRFHAQP LSANDTLKNKLLAALPFKPTGAQARVVAEIERDMALDVPMMRLVQGDVGS GKTLVAALAALRAIAHGKQVALMAPTELLAEQHANNFRNWFAPLGIEVGW LAGKQKGKARLAQQEAIASGQVQMIVGTHAIFQEQVQFNGLALVIIDEQH RFGVHQRLALWEKGQQQGFHPHQLIMTATPIPRTLAMTAYADLDTSVIDE LPPGRTPVTTVAIPDTRRTDIIDRVHHACITEGRQAYWVCTLIEESELLE AQAAEATWEELKLALPELNVGLVHGRMKPAEKQAVMASFKQGELHLLVAT TVIEVGVDVPNASLMIIENPERLGLAQLHQLRGRVGRGAVASHCVLLYKT PLSKTAQIRLQVLRDSNDGFVIAQKDLEIRGPGELLGTRQTGNAEFKVAD LLRDQAMIPEVQRLARHIHERYPQQAKALIERWMPETERYSNA |
References:
| Title | Authors | Journal |
| Molecular organization and nucleotide sequence of the recG locus of Escherichia coli K-12. | Lloyd RG, Sharples GJ | J Bacteriol Nov. 1, 1991 |
| The nucleotide sequence of recG, the distal spo operon gene in Escherichia coli K-12. | Kalman M, Murphy H, Cashel M | Gene Feb. 2, 1992 |
| DNA sequence and analysis of 136 kilobases of the Escherichia coli genome: organizational symmetry around the origin of replication. | Burland V, Plunkett G 3rd, Daniels DL, Blattner FR | Genomics June 1, 1993 |
| Branch migration of Holliday junctions: identification of RecG protein as a junction specific DNA helicase. | Whitby MC, Vincent SD, Lloyd RG | EMBO J Nov. 1, 1994 |
| Escherichia coli RecG and RecA proteins in R-loop formation. | Hong X, Cadwell GW, Kogoma T | EMBO J May 15, 1995 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| radC102 of Escherichia coli is an allele of recG. | Lombardo MJ, Rosenberg SM | J Bacteriol Nov. 1, 2000 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|