Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RecO |
Protein FULL name:
recO [Escherichia coli].
RecO (Escherichia coli strain K-12 substr. MG1655) is product of expression of recO gene.
RecO is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
- RecA and RecFOR join and start the filament formation in Escherichia coli strain K-12 substr. MG1655
FUNCTION: Involved in DNA repair and recF pathway recombination.
SUBUNIT: Monomer.
SIMILARITY: Belongs to the recO family.
| NCBI GenPept GI number(s): |
499369 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A7H3 |
P0A7H3 |
| PFAM: | - |
P0A7H3 (Link - using uniprot id) |
| InterPro: | - |
P0A7H3 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGAL QPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVL EYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTH CAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDAD TLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE |
References:
| Title | Authors | Journal |
| Genetic analysis of the rnc operon of Escherichia coli. | Takiff HE, Chen SM, Court DL | J Bacteriol May 1, 1989 |
| Molecular analysis of the Escherichia coli recO gene. | Morrison PT, Lovett ST, Gilson LE, Kolodner R | J Bacteriol July 1, 1989 |
| Suppression of insertions in the complex pdxJ operon of Escherichia coli K-12 by lon and other mutations. | Lam HM, Tancula E, Dempsey WB, Winkler ME | J Bacteriol March 1, 1992 |
| Purification and characterization of the Escherichia coli RecO protein. Renaturation of complementary single-stranded DNA molecules catalyzed by the RecO protein. | Luisi-DeLuca C, Kolodner R | J Mol Biol Jan. 11, 1994 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|