|
|
Protein FULL name: recO [Escherichia coli].
RecO (Escherichia coli strain K-12 substr. MG1655) is product of expression of
recO
gene.
RecO is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
FUNCTION: Involved in DNA repair and recF pathway recombination.
SUBUNIT: Monomer.
SIMILARITY: Belongs to the recO family.
Links to other databases:
Protein sequence:
MEGWQRAFVLHSRPWSETSLMLDVFTEESGRVRLVAKGARSKRSTLKGAL
QPFTPLLLRFGGRGEVKTLRSAEAVSLALPLSGITLYSGLYINELLSRVL
EYETRFSELFFDYLHCIQSLAGVTGTPEPALRRFELALLGHLGYGVNFTH
CAGSGEPVDDTMTYRYREEKGFIASVVIDNKTFTGRQLKALNAREFPDAD
TLRAAKRFTRMALKPYLGGKPLKSRELFRQFMPKRTVKTHYE
|
References:
|
Title
|
Authors
|
Journal
|
|
Genetic analysis of the rnc operon of Escherichia coli.
|
Takiff HE, Chen SM, Court DL
|
J Bacteriol
May 1, 1989
|
|
Molecular analysis of the Escherichia coli recO gene.
|
Morrison PT, Lovett ST, Gilson LE, Kolodner R
|
J Bacteriol
July 1, 1989
|
|
Suppression of insertions in the complex pdxJ operon of Escherichia coli K-12 by lon and other mutations.
|
Lam HM, Tancula E, Dempsey WB, Winkler ME
|
J Bacteriol
March 1, 1992
|
|
Purification and characterization of the Escherichia coli RecO protein. Renaturation of complementary single-stranded DNA molecules catalyzed by the RecO protein.
|
Luisi-DeLuca C, Kolodner R
|
J Mol Biol
Jan. 11, 1994
|
|
The complete genome sequence of Escherichia coli K-12.
|
Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y
|
Science
Sept. 5, 1997
|
|
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
|
Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T
|
Mol Syst Biol
Jan. 1, 2006
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|