Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RecQ |
Protein FULL name:
recQ [Escherichia coli].
RecQ (Escherichia coli strain K-12 substr. MG1655) is product of expression of recQ gene.
RecQ is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
FUNCTION: Involved in the recF recombination pathway; its gene expression is under the regulation of the SOS system. It is a DNA helicase.
CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.
SIMILARITY: Belongs to the helicase family. RecQ subfamily.
SIMILARITY: Contains 1 helicase ATP-binding domain.
SIMILARITY: Contains 1 helicase C-terminal domain.
SIMILARITY: Contains 1 HRDC domain.
SEQUENCE CAUTION: Sequence=AAA24517.1; Type=Erroneous initiation; Sequence=AAA67618.1; Type=Erroneous initiation;
| NCBI GenPept GI number(s): |
147559 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P15043 |
P15043 |
| PFAM: | - |
P15043 (Link - using uniprot id) |
| InterPro: | - |
P15043 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MNVAQAEVLNLESGAKQVLQETFGYQQFRPGQEEIIDTVLSGRDCLVVMP TGGGKSLCYQIPALLLNGLTVVVSPLISLMKDQVDQLQANGVAAACLNST QTREQQLEVMTGCRTGQIRLLYIAPERLMLDNFLEHLAHWNPVLLAVDEA HCISQWGHDFRPEYAALGQLRQRFPTLPFMALTATADDTTRQDIVRLLGL NDPLIQISSFDRPNIRYMLMEKFKPLDQLMRYVQEQRGKSGIIYCNSRAK VEDTAAALQSKGISAAAYHAGLENNVRADVQEKFQRDDLQIVVATVAFGM GINKPNVRFVVHFDIPRNIESYYQETGRAGRDGLPAEAMLFYDPADMAWL RRCLEEKPQGQLQDIERHKLNAMGAFAEAQTCRRLVLLNYFGEGRQEPCG NCDICLDPPKQYDGSTDAQIALSTIGRVNQRFGMGYVVEVIRGANNQRIR DYGHDKLKVYGMGRDKSHEHWVSVIRQLIHLGLVTQNIAQHSALQLTEAA RPVLAESSLQLAVPRIVALKPKAMQKSFGGNYDRKLFAKLRKLRKSIADE SNVPPYVVFNDATLIEMAEQMPITASEMLSVNGVGMRKLERFGKPFMALI PAHVDGDDEE |
References:
| Title | Authors | Journal |
| The recQ gene of Escherichia coli K12: primary structure and evidence for SOS regulation. | Irino N, Nakayama K, Nakayama H | Mol Gen Genet Nov. 1, 1986 |
| Escherichia coli RecQ protein is a DNA helicase. | Umezu K, Nakayama K, Nakayama H | Proc Natl Acad Sci U S A July 1, 1990 |
| Analysis of the Escherichia coli genome: DNA sequence of the region from 84.5 to 86.5 minutes. | Daniels DL, Plunkett G 3rd, Burland V, Blattner FR | Science Aug. 7, 1992 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
| Escherichia coli K-12: a cooperatively developed annotation snapshot--2005. | Riley M, Abe T, Arnaud MB, Berlyn MK, Blattner FR, Chaudhuri RR, Glasner JD, Horiuchi T, Keseler IM, Kosuge T, Mori H, Perna NT, Plunkett G 3rd, Rudd KE, Serres MH, Thomas GH, Thomson NR, Wishart D, Wanner BL | Nucleic Acids Res Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|