|
|
Protein FULL name: unknown [Escherichia coli].
RecT (Escherichia coli strain K-12 substr. MG1655) is product of expression of
recT
gene.
FUNCTION: Binds to single-stranded DNA and also promotes the
renaturation of complementary single-stranded DNA. Function in
recombination. Has a function similar to that of lambda redB.
SUBUNIT: Homotetramer.
Links to other databases:
Protein sequence:
MTKQPPIAKADLQKTQGNRAPAAVKNSDVISFINQPSMKEQLAAALPRHM
TAERMIRIATTEIRKVPALGNCDTMSFVSAIVQCSQLGLEPGSALGHAYL
LPFGNKNEKSGKKNVQLIIGYRGMIDLARRSGQIASLSARVVREGDEFSF
EFGLDEKLIHRPGENEDAPVTHVYAVARLKDGGTQFEVMTRKQIELVRSL
SKAGNNGPWVTHWEEMAKKTAIRRLFKYLPVSIEIQRAVSMDEKEPLTID
PADSSVLTGEYSVIDNSEE
|
References:
|
Title
|
Authors
|
Journal
|
|
Identification and characterization of the Escherichia coli RecT protein, a protein encoded by the recE region that promotes renaturation of homologous single-stranded DNA.
|
Hall SD, Kane MF, Kolodner RD
|
J Bacteriol
Feb. 1, 1993
|
|
Genetic and molecular analyses of the C-terminal region of the recE gene from the Rac prophage of Escherichia coli K-12 reveal the recT gene.
|
Clark AJ, Sharma V, Brenowitz S, Chu CC, Sandler S, Satin L, Templin A, Berger I, Cohen A
|
J Bacteriol
Dec. 1, 1993
|
|
A 570-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 28.0-40.1 min region on the linkage map.
|
Aiba H, Baba T, Hayashi K, Inada T, Isono K, Itoh T, Kasai H, Kashimoto K, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Horiuchi T, et al.
|
DNA Res
Dec. 31, 1996
|
|
The complete genome sequence of Escherichia coli K-12.
|
Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y
|
Science
Sept. 5, 1997
|
|
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
|
Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T
|
Mol Syst Biol
Jan. 1, 2006
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|