Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RFC5 |
Protein FULL name:
Replication factor C subunit 5, Activator 1 subunit 5, Replication factor C 36 kDa subunit, Activator 1 36 kDa subunit,
Protein SHORT name:
RF-C 36 kDa subunit RFC36 A1 36 kDa subunit.
RFC5 (Homo sapiens) is product of expression of RFC5 gene.
RFC5 is involved in:
DDS in Homo sapiens
FUNCTION: The elongation of primed DNA templates by DNA polymerase delta and epsilon requires the action of the accessory proteins proliferating cell nuclear antigen (PCNA) and activator 1.
SUBUNIT: Heterotetramer of subunits RFC2, RFC3, RFC4 and RFC5 that can form a complex either with RFC1 or with RAD17. The former interacts with PCNA in the presence of ATP, while the latter has ATPase activity but is not stimulated by PCNA.
INTERACTION: P25942:CD40; NbExp=1; IntAct=EBI-712376, EBI-525714;
SUBCELLULAR LOCATION: Nucleus (Probable).
SIMILARITY: Belongs to the activator 1 small subunits family.
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
This protein can be a part of a given complexes:
| NCBI GenPept GI number(s): |
728777 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | P40937 |
P40937 |
| PFAM: |
PF00004 PF08542 |
PF00004 PF08542 |
| InterPro: |
IPR003593 IPR003959 IPR008921 IPR013748 |
IPR003593 IPR003959 IPR008921 IPR013748 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE DRLPHLLLYGPPGTGKTSTILACAKQLYKDKEFGSMVLELNASDDRGIDI IRGPILSFASTRTIFKKGFKLVILDEADAMTQDAQNALRRVIEKFTENTR FCLICNYLSKIIPALQSRCTRFRFGPLTPELMVPRLEHVVEEEKVDISED GMKALVTLSSGDMRRALNILQSTNMAFGKVTEETVYTCTGHPLKSDIANI LDWMLNQDFTTAYRNITELKTLKGLALHDILTEIHLFVHRVDFPSSVRIH LLTKMADIEYRLSVGTNEKIQLSSLIAAFQVTRDLIVAEA |
RFC5 (Homo sapiens) belongs to following protein families:
References:
| Title | Authors | Journal |
| Homology in accessory proteins of replicative polymerases--E. coli to humans. | O'Donnell M, Onrust R, Dean FB, Chen M, Hurwitz J | Nucleic Acids Res Feb. 11, 1993 |
| Replication factor C interacts with the C-terminal side of proliferating cell nuclear antigen. | Mossi R, Jonsson ZO, Allen BL, Hardin SH, Hubscher U | J Biol Chem Feb. 17, 1997 |
| Purification and characterization of human DNA damage checkpoint Rad complexes. | Lindsey-Boltz LA, Bermudez VP, Hurwitz J, Sancar A | Proc Natl Acad Sci U S A Sept. 25, 2001 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|