Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RuvA |
Protein FULL name:
unnamed protein product [Escherichia coli].
RuvA (Escherichia coli strain K-12 substr. MG1655) is product of expression of ruvA gene.
RuvA is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
- Replication restart (from RecG branch migration) in Escherichia coli strain K-12 substr. MG1655
- RuvABC restorate two intact helices in RecFOR pathway in Escherichia coli strain K-12 substr. MG1655
- RuvABC start branch migration and resolution of Holliday junction in Escherichia coli strain K-12 substr. MG1655
- RuvABC start branch migration and resolution of Holliday junction in RecFOR pathway in Escherichia coli strain K-12 substr. MG1655
FUNCTION: The ruvA-ruvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is an helicase that mediates the Holliday junction migration by localized denaturation and reannealing. RuvA stimulates, in the presence of DNA, the weak ATPase activity of ruvB. Binds both single- and double-stranded DNA (dsDNA). Binds preferentially to supercoiled rather than to relaxed dsDNA.
CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.
SUBUNIT: Homotetramer; forms a complex with ruvB.
INDUCTION: Expression of the ruv region is induced by damage to DNA and is regulated by lexA as part of the SOS response. RuvA and ruvB are also involved in mutagenesis induced by UV and X irradiation and by some chemicals.
SIMILARITY: Belongs to the ruvA family.
| NCBI GenPept GI number(s): |
581226 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A809 |
P0A809 |
| PFAM: | - |
P0A809 (Link - using uniprot id) |
| InterPro: |
IPR000085 IPR003583 IPR011114 IPR012340 IPR013849 |
IPR000085 IPR003583 IPR011114 IPR012340 IPR013849 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | 1BDX 1C7Y 1CUK 1D8L 1HJP |
1BDX 1C7Y 1CUK 1D8L 1HJP |
Protein sequence:
|
MIGRLRGIIIEKQPPLVLIEVGGVGYEVHMPMTCFYELPEAGQEAIVFTH FVVREDAQLLYGFNNKQERTLFKELIKTNGVGPKLALAILSGMSAQQFVN AVEREEVGALVKLPGIGKKTAERLIVEMKDRFKGLHGDLFTPAADLVLTS PASPATDDAEQEAVARLVALGYKPQEASRMVSKIARPDASSETLIREALR AAL |
Solved crystal structures:
References:
| Title | Authors | Journal |
| Nucleotide sequencing of the ruv region of Escherichia coli K-12 reveals a LexA regulated operon encoding two genes. | Benson FE, Illing GT, Sharples GJ, Lloyd RG | Nucleic Acids Res Jan. 25, 1988 |
| Structure and regulation of the Escherichia coli ruv operon involved in DNA repair and recombination. | Shinagawa H, Makino K, Amemura M, Kimura S, Iwasaki H, Nakata A | J Bacteriol Sept. 1, 1988 |
| Molecular analysis of the Escherichia coli ruvC gene, which encodes a Holliday junction-specific endonuclease. | Takahagi M, Iwasaki H, Nakata A, Shinagawa H | J Bacteriol Sept. 1, 1991 |
| RuvA and RuvB proteins of Escherichia coli exhibit DNA helicase activity in vitro. | Tsaneva IR, Muller B, West SC | Proc Natl Acad Sci U S A Jan. 15, 1993 |
| Crystal structure of DNA recombination protein RuvA and a model for its binding to the Holliday junction. | Rafferty JB, Sedelnikova SE, Hargreaves D, Artymiuk PJ, Baker PJ, Sharples GJ, Mahdi AA, Lloyd RG, Rice DW | Science Oct. 18, 1996 |
| A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. | Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al. | DNA Res Dec. 31, 1996 |
| Processing of recombination intermediates by the RuvABC proteins. | West SC | Annu Rev Genet Jan. 1, 1997 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Functional analyses of the domain structure in the Holliday junction binding protein RuvA. | Nishino T, Ariyoshi M, Iwasaki H, Shinagawa H, Morikawa K | Structure Feb. 15, 1998 |
| Crystal structure of E.coli RuvA with bound DNA Holliday junction at 6 A resolution. | Hargreaves D, Rice DW, Sedelnikova SE, Artymiuk PJ, Lloyd RG, Rafferty JB | Nat Struct Biol June 1, 1998 |
| Modulation of RuvB function by the mobile domain III of the Holliday junction recognition protein RuvA. | Nishino T, Iwasaki H, Kataoka M, Ariyoshi M, Fujita T, Shinagawa H, Morikawa K | J Mol Biol May 5, 2000 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|