Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RuvB |
Protein FULL name:
unnamed protein product [Escherichia coli].
RuvB (Escherichia coli strain K-12 substr. MG1655) is product of expression of ruvB gene.
RuvB is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
- Replication restart (from RecG branch migration) in Escherichia coli strain K-12 substr. MG1655
- RuvABC restorate two intact helices in RecFOR pathway in Escherichia coli strain K-12 substr. MG1655
- RuvABC start branch migration and resolution of Holliday junction in Escherichia coli strain K-12 substr. MG1655
- RuvABC start branch migration and resolution of Holliday junction in RecFOR pathway in Escherichia coli strain K-12 substr. MG1655
FUNCTION: The ruvA-ruvB complex in the presence of ATP renatures cruciform structure in supercoiled DNA with palindromic sequence, indicating that it may promote strand exchange reactions in homologous recombination. RuvAB is an helicase that mediates the Holliday junction migration by localized denaturation and reannealing.
CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate.
ENZYME REGULATION: RuvB possesses weak ATPase activity, which is stimulated by the ruvA protein in the presence of DNA.
SUBUNIT: Homododecamer composed of two hexameric rings; when bound to DNA in the presence of ATP and magnesium. Forms a complex with ruvA.
INDUCTION: Expression of the ruv region is induced by damage to DNA and is regulated by lexA as part of the SOS response. RuvA and ruvB are also involved in mutagenesis induced by UV and X irradiation and by some chemicals.
SIMILARITY: Belongs to the ruvB family.
| NCBI GenPept GI number(s): |
42903 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A812 |
P0A812 |
| PFAM: | - |
P0A812 (Link - using uniprot id) |
| InterPro: |
IPR001984 IPR003593 IPR003959 IPR004605 IPR008823 IPR008824 IPR011991 |
IPR001984 IPR003593 IPR003959 IPR004605 IPR008823 IPR008824 IPR011991 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MIEADRLISAGTTLPEDVADRAIRPKLLEEYVGQPQVRSQMEIFIKAAKL RGDALDHLLIFGPPGLGKTTLANIVANEMGVNLRTTSGPVLEKAGDLAAM LTNLEPHDVLFIDEIHRLSPVVEEVLYPAMEDYQLDIMIGEGPAARSIKI DLPPFTLIGATTRAGSLTSPLRDRFGIVQRLEFYQVPDLQYIVSRSARFM GLEMSDDGALEVARRARGTPRIANRLLRRVRDFAEVKHDGTISADIAAQA LDMLNVDAEGFDYMDRKLLLAVIDKFFGGPVGLDNLAAAIGEERETIEDV LEPYLIQQGFLQRTPRGRMATTRAWNHFGITPPEMP |
References:
| Title | Authors | Journal |
| Nucleotide sequencing of the ruv region of Escherichia coli K-12 reveals a LexA regulated operon encoding two genes. | Benson FE, Illing GT, Sharples GJ, Lloyd RG | Nucleic Acids Res Jan. 25, 1988 |
| Structure and regulation of the Escherichia coli ruv operon involved in DNA repair and recombination. | Shinagawa H, Makino K, Amemura M, Kimura S, Iwasaki H, Nakata A | J Bacteriol Sept. 1, 1988 |
| RuvA and RuvB proteins of Escherichia coli exhibit DNA helicase activity in vitro. | Tsaneva IR, Muller B, West SC | Proc Natl Acad Sci U S A Jan. 15, 1993 |
| A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. | Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al. | DNA Res Dec. 31, 1996 |
| Processing of recombination intermediates by the RuvABC proteins. | West SC | Annu Rev Genet Jan. 1, 1997 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|