|
|
Protein FULL name: ruvC [Escherichia coli].
RuvC (Escherichia coli strain K-12 substr. MG1655) is product of expression of
ruvC
gene.
RuvC is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
FUNCTION: Nuclease that resolves Holliday junction intermediates
in genetic recombination. Cleaves the cruciform structure in
supercoiled DNA by nicking to strands with the same polarity at
sites symmetrically opposed at the junction in the homologous arms
and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl
group.
CATALYTIC ACTIVITY: Endonucleolytic cleavage at a junction such as
a reciprocal single-stranded crossover between two homologous DNA
duplexes (Holliday junction).
COFACTOR: Binds 1 magnesium ion per subunit.
SUBUNIT: Homodimer.
INTERACTION:
P0A6F5:groL; NbExp=1; IntAct=EBI-1123014, EBI-543750;
SIMILARITY: Belongs to the ruvC family.
Links to other databases:
Protein sequence:
MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYA
GVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVF
EYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITH
CHVSQNAMQMSESRLNLARGRLR
|
Solved crystal structures:
References:
|
Title
|
Authors
|
Journal
|
|
Formation and resolution of recombination intermediates by E. coli RecA and RuvC proteins.
|
Dunderdale HJ, Benson FE, Parsons CA, Sharples GJ, Lloyd RG, West SC
|
Nature
Jan. 1, 1991
|
|
Molecular analysis of the Escherichia coli ruvC gene, which encodes a Holliday junction-specific endonuclease.
|
Takahagi M, Iwasaki H, Nakata A, Shinagawa H
|
J Bacteriol
Sept. 1, 1991
|
|
Resolution of Holliday junctions in Escherichia coli: identification of the ruvC gene product as a 19-kilodalton protein.
|
Sharples GJ, Lloyd RG
|
J Bacteriol
Dec. 1, 1991
|
|
Escherichia coli RuvC protein is an endonuclease that resolves the Holliday structure.
|
Iwasaki H, Takahagi M, Shiba T, Nakata A, Shinagawa H
|
EMBO J
Dec. 1, 1991
|
|
Atomic structure of the RuvC resolvase: a holliday junction-specific endonuclease from E. coli.
|
Ariyoshi M, Vassylyev DG, Iwasaki H, Nakamura H, Shinagawa H, Morikawa K
|
Cell
Sept. 23, 1994
|
|
A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map.
|
Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al.
|
DNA Res
Dec. 31, 1996
|
|
Processing of recombination intermediates by the RuvABC proteins.
|
West SC
|
Annu Rev Genet
Jan. 1, 1997
|
|
The complete genome sequence of Escherichia coli K-12.
|
Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y
|
Science
Sept. 5, 1997
|
|
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
|
Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T
|
Mol Syst Biol
Jan. 1, 2006
|
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|