Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RuvC |
Protein FULL name:
ruvC [Escherichia coli].
RuvC (Escherichia coli strain K-12 substr. MG1655) is product of expression of ruvC gene.
RuvC is involved in:
HRR in Escherichia coli strain K-12 substr. MG1655
- Replication restart (from RecG branch migration) in Escherichia coli strain K-12 substr. MG1655
- RuvABC restorate two intact helices in RecFOR pathway in Escherichia coli strain K-12 substr. MG1655
- RuvABC start branch migration and resolution of Holliday junction in Escherichia coli strain K-12 substr. MG1655
- RuvABC start branch migration and resolution of Holliday junction in RecFOR pathway in Escherichia coli strain K-12 substr. MG1655
FUNCTION: Nuclease that resolves Holliday junction intermediates in genetic recombination. Cleaves the cruciform structure in supercoiled DNA by nicking to strands with the same polarity at sites symmetrically opposed at the junction in the homologous arms and leaves a 5'-terminal phosphate and a 3'-terminal hydroxyl group.
CATALYTIC ACTIVITY: Endonucleolytic cleavage at a junction such as a reciprocal single-stranded crossover between two homologous DNA duplexes (Holliday junction).
COFACTOR: Binds 1 magnesium ion per subunit.
SUBUNIT: Homodimer.
INTERACTION: P0A6F5:groL; NbExp=1; IntAct=EBI-1123014, EBI-543750;
SIMILARITY: Belongs to the ruvC family.
| NCBI GenPept GI number(s): |
42175 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P0A814 |
P0A814 |
| PFAM: | - |
P0A814 (Link - using uniprot id) |
| InterPro: |
IPR002176 |
IPR002176 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | 1HJR |
1HJR |
Protein sequence:
|
MAIILGIDPGSRVTGYGVIRQVGRQLSYLGSGCIRTKVDDLPSRLKLIYA GVTEIITQFQPDYFAIEQVFMAKNADSALKLGQARGVAIVAAVNQELPVF EYAARQVKQTVVGIGSAEKSQVQHMVRTLLKLPANPQADAADALAIAITH CHVSQNAMQMSESRLNLARGRLR |
Solved crystal structures:
References:
| Title | Authors | Journal |
| Formation and resolution of recombination intermediates by E. coli RecA and RuvC proteins. | Dunderdale HJ, Benson FE, Parsons CA, Sharples GJ, Lloyd RG, West SC | Nature Jan. 1, 1991 |
| Molecular analysis of the Escherichia coli ruvC gene, which encodes a Holliday junction-specific endonuclease. | Takahagi M, Iwasaki H, Nakata A, Shinagawa H | J Bacteriol Sept. 1, 1991 |
| Resolution of Holliday junctions in Escherichia coli: identification of the ruvC gene product as a 19-kilodalton protein. | Sharples GJ, Lloyd RG | J Bacteriol Dec. 1, 1991 |
| Escherichia coli RuvC protein is an endonuclease that resolves the Holliday structure. | Iwasaki H, Takahagi M, Shiba T, Nakata A, Shinagawa H | EMBO J Dec. 1, 1991 |
| Atomic structure of the RuvC resolvase: a holliday junction-specific endonuclease from E. coli. | Ariyoshi M, Vassylyev DG, Iwasaki H, Nakamura H, Shinagawa H, Morikawa K | Cell Sept. 23, 1994 |
| A 460-kb DNA sequence of the Escherichia coli K-12 genome corresponding to the 40.1-50.0 min region on the linkage map. | Itoh T, Aiba H, Baba T, Hayashi K, Inada T, Isono K, Kasai H, Kimura S, Kitakawa M, Kitagawa M, Makino K, Miki T, Mizobuchi K, Mori H, Mori T, Motomura K, Nakade S, Nakamura Y, Nashimoto H, Nishio Y, Oshima T, Saito N, Sampei G, Seki Y, Horiuchi T, et al. | DNA Res Dec. 31, 1996 |
| Processing of recombination intermediates by the RuvABC proteins. | West SC | Annu Rev Genet Jan. 1, 1997 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|