Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
Alkbh3 |
Protein FULL name:
alpha-ketoglutarate-dependent dioxygenase alkB homolog 3 [Mus musculus].
Alkbh3 (Mus musculus) is product of expression of Alkbh3 gene.
FUNCTION: Dioxygenase that repairs alkylated DNA and RNA containing 1-methyladenine and 3-methylcytosine by oxidative demethylation. Has a preference for single-stranded substrates. Requires molecular oxygen, alpha-ketoglutarate and iron.
COFACTOR: Binds 1 Fe(2+) ion per subunit.
ENZYME REGULATION: Activated by ascorbate (By similarity).
SUBCELLULAR LOCATION: Cytoplasm. Nucleus (By similarity).
TISSUE SPECIFICITY: Detected in testis, kidney, liver and heart.
DISRUPTION PHENOTYPE: No visible phenotype.
SIMILARITY: Belongs to the alkB family.
SIMILARITY: Contains 1 Fe2OG dioxygenase domain.
| NCBI GenPept GI number(s): |
110625726 |
| Species: | Mus musculus |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q8K1E6 |
Q8K1E6 |
| PFAM: | - |
Q8K1E6 (Link - using uniprot id) |
| InterPro: | - |
Q8K1E6 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MEDKRQRARVQGGWATPTKSQSATQPASPARSRLSQTAGPAWRSKEQQQC DRQFVFKEPQLVVRAAPEPRVIDREGVYEISLSPTGVSRVCLYPGFVDLK EADWILEQLCKDVPWKQRMGIREDVTYPQPRLTAWYGELPYTYSRITMEP NPHWLPVLWTLKSRIEENTSHTFNSLLCNFYRDEKDSVDWHSDDEPSLGS CPVIASLSFGATRTFEMRKKPPPEENGDYTYVERVKIPLDHGTLLIMEGA TQADWQHRVPKEYHSRQPRVNLTFRTVYPDPRGAPR |
Alkbh3 (Mus musculus) is able to recognize following damages:
Alkbh3 (Mus musculus) belongs to following protein families:
References:
| Title | Authors | Journal |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
| Repair of methylation damage in DNA and RNA by mammalian AlkB homologues. | Lee DH, Jin SG, Cai S, Chen Y, Pfeifer GP, O'Connor TR | J Biol Chem Nov. 25, 2005 |
| Repair deficient mice reveal mABH2 as the primary oxidative demethylase for repairing 1meA and 3meC lesions in DNA. | Ringvoll J, Nordstrand LM, Vagbo CB, Talstad V, Reite K, Aas PA, Lauritzen KH, Liabakk NB, Bjork A, Doughty RW, Falnes PO, Krokan HE, Klungland A | EMBO J May 17, 2006 |
| AlkB homologue 2-mediated repair of ethenoadenine lesions in mammalian DNA. | Ringvoll J, Moen MN, Nordstrand LM, Meira LB, Pang B, Bekkelund A, Dedon PC, Bjelland S, Samson LD, Falnes PO, Klungland A | Cancer Res June 1, 2008 |
Last modification of this entry: Oct. 6, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|