|
|
Protein FULL name: 3-methyl-adenine DNA glycosylase I, constitutive [Escherichia coli str. K-12 substr. MG1655].
Tag (Escherichia coli strain K-12 substr. MG1655) is product of expression of
tag
gene.
Tag is involved in:
BER in Escherichia coli strain K-12 substr. MG1655
Keywords:
FUNCTION: Hydrolysis of the deoxyribose N-glycosidic bond to
excise 3-methyladenine from the damaged DNA polymer formed by
alkylation lesions.
CATALYTIC ACTIVITY: Hydrolysis of alkylated DNA, releasing 3-
methyladenine.
ENZYME REGULATION: Activity is controlled by product inhibition.
INTERACTION:
P0AFG8:aceE; NbExp=1; IntAct=EBI-558722, EBI-542683;
Links to other databases:
Protein sequence:
MERCGWVSQDPLYIAYHDNEWGVPETDSKKLFEMICLEGQQAGLSWITVL
KKRENYRACFHQFDPVKVAAMQEEDVERLVQDAGIIRHRGKIQAIIGNAR
AYLQMEQNGEPFVDFVWSFVNHQPQVTQATTLSEIPTSTSASDALSKALK
KRGFKFVGTTICYSFMQACGLVNDHVVGCCCYPGNKP
|
Tag (Escherichia coli strain K-12 substr. MG1655) is able to recognize following damages:
References:
|
Title
|
Authors
|
Journal
|
|
Nucleotide sequence of the tag gene from Escherichia coli.
|
Steinum AL, Seeberg E
|
Nucleic Acids Res
May 12, 1986
|
|
Purification and structure of 3-methyladenine-DNA glycosylase I of Escherichia coli.
|
Sakumi K, Nakabeppu Y, Yamamoto Y, Kawabata S, Iwanaga S, Sekiguchi M
|
J Biol Chem
Nov. 25, 1986
|
|
Analysis of the Escherichia coli genome. V. DNA sequence of the region from 76.0 to 81.5 minutes.
|
Sofia HJ, Burland V, Daniels DL, Plunkett G 3rd, Blattner FR
|
Nucleic Acids Res
July 11, 1994
|
|
The complete genome sequence of Escherichia coli K-12.
|
Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y
|
Science
Sept. 5, 1997
|
|
3-Methyladenine DNA glycosylase I is an unexpected helix-hairpin-helix superfamily member.
|
Drohat AC, Kwon K, Krosky DJ, Stivers JT
|
Nat Struct Biol
Sept. 1, 2002
|
|
A novel zinc snap motif conveys structural stability to 3-methyladenine DNA glycosylase I.
|
Kwon K, Cao C, Stivers JT
|
J Biol Chem
May 23, 2003
|
|
Solution structure and base perturbation studies reveal a novel mode of alkylated base recognition by 3-methyladenine DNA glycosylase I.
|
Cao C, Kwon K, Jiang YL, Drohat AC, Stivers JT
|
J Biol Chem
Nov. 28, 2003
|
|
Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110.
|
Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T
|
Mol Syst Biol
Jan. 1, 2006
|
Last modification of this entry: Oct. 15, 2010.
Add your own comment!
There is no comment yet.
|