Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
AidB |
Protein FULL name:
Protein AidB.
AidB (Escherichia coli strain K-12 substr. MG1655) is product of expression of aidB gene.
AidB is involved in:
DDS in Escherichia coli strain K-12 substr. MG1655
Keywords:
Upon exposure to alkylating agents, Escherichia coli increases expression of aidB along with three genes (ada, alkA, and alkB) that encode DNA repair proteins. While the biological roles of Ada, AlkA and AlkB proteins have been defined, despite many efforts, the molecular functions of AidB remain largely unknown. In this study, we focused on the biological role of the AidB protein and we demonstrated that AidB shows preferential binding to a DNA region that includes the upstream element of its own promoter, PaidB. The physiological significance of this specific interaction was investigated by in vivo gene expression assays demonstrating that AidB can repress its own synthesis during the normal cell growth. We also showed that the domain architecture of AidB is related to the different functions of the protein: the N-terminal region comprising the first 439 amino acids (AidB 'I-III') possesses FAD-dependent dehydrogenase activity while its C-terminal domain corresponding to residues 440-541 (AidB 'IV') displays DNA binding activity and can negatively regulate the expression of its own gene in vivo.
INDUCTION: By alkylating agents.
SIMILARITY: Belongs to the acyl-CoA dehydrogenase family.
SEQUENCE CAUTION: Sequence=AAA97083.1; Type=Erroneous initiation; Note=Translation N-terminally shortened; Sequence=AAC18889.1; Type=Erroneous initiation; Note=Translation N-terminally shortened;
| NCBI GenPept GI number(s): |
12644215 |
| Species: | Escherichia coli |
Links to other databases:
| Database | ID | Link |
| Uniprot | P33224 |
P33224 |
| PFAM: |
PF00441 PF02770 |
PF00441 PF02770 |
| InterPro: |
IPR006089 IPR006090 IPR006091 IPR009075 IPR009100 IPR013764 |
IPR006089 IPR006090 IPR006091 IPR009075 IPR009100 IPR013764 |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MHWQTHTVFNQPIPLNNSNLYLSDGALCEAVTREGAGWDSDFLASIGQQL GTAESLELGRLANVNPPELLRYDAQGRRLDDVRFHPAWHLLMQALCTNRV HNLAWEEDARSGAFVARAARFMLHAQVEAGSLCPITMTFAATPLLLQMLP APFQDWTTPLLSDRYDSHLLPGGQKRGLLIGMGMTEKQGGSDVMSNTTRA ERLEDGSYRLVGHKWFFSVPQSDAHLVLAQTAGGLSCFFVPRFLPDGQRN AIRLERLKDKLGNRSNASCEVEFQDAIGWLLGLEGEGIRLILKMGGMTRF DCALGSHAMMRRAFSLAIYHAHQRHVFGNPLIQQPLMRHVLSRMALQLEG QTALLFRLARAWDRRADAKEALWARLFTPAAKFVICKRGMPFVAEAMEVL GGIGYCEESELPRLYREMPVNSIWEGSGNIMCLDVLRVLNKQAGVYDLLS EAFVEVKGQDRYFDRAVRRLQQQLRKPAEELGREITHQLFLLGCGAQMLK YASPPMAQAWCQVMLDTRGGVRLSEQIQNDLLLRATGGVCV |
AidB (Escherichia coli strain K-12 substr. MG1655) belongs to following protein families:
References:
| Title | Authors | Journal |
| Structure and transcriptional regulation of the Escherichia coli adaptive response gene aidB. | Landini P, Hajec LI, Volkert MR | J Bacteriol Nov. 1, 1994 |
| Analysis of the Escherichia coli genome VI: DNA sequence of the region from 92.8 through 100 minutes. | Burland V, Plunkett G 3rd, Sofia HJ, Daniels DL, Blattner FR | Nucleic Acids Res June 25, 1995 |
| The complete genome sequence of Escherichia coli K-12. | Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y | Science Sept. 5, 1997 |
| Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. | Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T | Mol Syst Biol Jan. 1, 2006 |
Last modification of this entry: Oct. 18, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|