Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
PMS6 |
Protein FULL name:
PMS6 [Homo sapiens].
PMS6 (Homo sapiens) is product of expression of PMS2L4 gene.
| NCBI GenPept GI number(s): |
1304123 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | Q16544 |
Q16544 |
| PFAM: | - |
Q16544 (Link - using uniprot id) |
| InterPro: | - |
Q16544 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
RVLSPWSELRARGTEPAKAIKPIDRKSVHQICSGPVVLSLSTAVKELVEN SLDAGATNIDLKLKDYGVDLIEVSDNGCGVEEENFEGLTMSPFLPATHRR RLGLDWCLITMGKSSRKPPTPTPEDHSQREAVISTLPVHHKEFQRNIKKT CLFPLRLLP |
References:
| Title | Authors | Journal |
| Cloning, characterization and chromosomal assignment of the human genes homologous to yeast PMS1, a member of mismatch repair genes. | Horii A, Han HJ, Sasaki S, Shimada M, Nakamura Y | Biochem Biophys Res Commun Nov. 15, 1994 |
Last modification of this entry: Oct. 14, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|