|
Protein FULL name: 26S proteasome complex subunit DSS1 [Homo sapiens].
SHFM1 (Homo sapiens) is product of expression of
SHFM1
gene.
FUNCTION: Subunit of the 26S proteasome which plays a role in
ubiquitin-dependent proteolysis.
SUBUNIT: Part of the 26S proteasome. Interacts with the C-terminal
of BRCA2.
INTERACTION:
P51587:BRCA2; NbExp=3; IntAct=EBI-79819, EBI-79792;
P97929:Brca2 (xeno); NbExp=1; IntAct=EBI-79819, EBI-1034100;
TISSUE SPECIFICITY: Expressed in limb bud, craniofacial primordia
and skin.
SIMILARITY: Belongs to the DSS1/SEM1 family.
WEB RESOURCE: Name=GeneReviews;
[LINK]
Links to other databases:
Protein sequence:
MSEKKQPVDLGLLEEDDEFEEFPAEDWAGLDEDEDAHVWEDNWDDDNVED
DFSNQLRAELEKHGYKMETS
|
SHFM1 (Homo sapiens) is able to recognize following damages:
SHFM1 (Homo sapiens) belongs to following protein families:
References:
Title
|
Authors
|
Journal
|
Characterization of the split hand/split foot malformation locus SHFM1 at 7q21.3-q22.1 and analysis of a candidate gene for its expression during limb development.
|
Crackower MA, Scherer SW, Rommens JM, Hui CC, Poorkaj P, Soder S, Cobben JM, Hudgins L, Evans JP, Tsui LC
|
Hum Mol Genet
May 1, 1996
|
Interaction between the product of the breast cancer susceptibility gene BRCA2 and DSS1, a protein functionally conserved from yeast to mammals.
|
Marston NJ, Richards WJ, Hughes D, Bertwistle D, Marshall CJ, Ashworth A
|
Mol Cell Biol
July 1, 1999
|
BRCA2 function in DNA binding and recombination from a BRCA2-DSS1-ssDNA structure.
|
Yang H, Jeffrey PD, Miller J, Kinnucan E, Sun Y, Thoma NH, Zheng N, Chen PL, Lee WH, Pavletich NP
|
Science
Sept. 13, 2002
|
The DNA sequence of human chromosome 7.
|
Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK
|
Nature
July 10, 2003
|
Sem1p is a novel subunit of the 26 S proteasome from Saccharomyces cerevisiae.
|
Sone T, Saeki Y, Toh-e A, Yokosawa H
|
J Biol Chem
July 2, 2004
|
The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
|
Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J
|
Genome Res
Oct. 1, 2004
|
Mass spectrometric characterization of the affinity-purified human 26S proteasome complex.
|
Wang X, Chen CF, Baker PR, Chen PL, Kaiser P, Huang L
|
Biochemistry
March 20, 2007
|
Last modification of this entry: Oct. 11, 2010.
Add your own comment!
There is no comment yet.
|