Welcome! Click here to login or here to register.
 |
|||||||||||||||||||
|
|||||||||||||||||||
 |
|||||||||||||||||||
RAD51C |
Protein FULL name:
DNA repair protein RAD51 homolog 3 isoform 2 [Homo sapiens].
RAD51C (Homo sapiens) is product of expression of RAD51C gene.
FUNCTION: Involved in the homologous recombination repair (HRR) pathway of double-stranded DNA breaks arising during DNA replication or induced by DNA-damaging agents. The RAD51B-RAD51C dimer exhibits single-stranded DNA-dependent ATPase activity. The BCDX2 complex binds single-stranded DNA, single-stranded gaps in duplex DNA and specifically to nicks in duplex DNA.
SUBUNIT: Interacts with RAD51B and XRCC3. Part of a BCDX2 complex consisting of RAD51B, RAD51C, RAD51D and XRCC2. Part of a complex consisting of RAD51B, RAD51C, RAD51D, XRCC2 and XRCC3. Part of a complex with RAD51B and RAD51.
SUBCELLULAR LOCATION: Nucleus (Probable).
TISSUE SPECIFICITY: Expressed in a variety of tissues, with highest expression in testis, heart muscle, spleen and prostate.
SIMILARITY: Belongs to the recA family. RAD51 subfamily.
WEB RESOURCE: Name=NIEHS-SNPs; [LINK]
| NCBI GenPept GI number(s): |
4506391 |
| Species: | Homo sapiens |
Links to other databases:
| Database | ID | Link |
| Uniprot | O43502 |
O43502 |
| PFAM: | - |
O43502 (Link - using uniprot id) |
| InterPro: | - |
O43502 (Link - using uniprot id) |
| CATH: | - | - |
| SCOP: | - | - |
| PDB: | - | - |
Protein sequence:
|
MRGKTFRFEMQRDLVSFPLSPAVRVKLVSAGFQTAEELLEVKPSELSKEV GISKAEALETLQIIRRECLTNKPRYAGTSESHKKCTALELLEQEHTQGFI ITFCSALDDILGGGVPLMKTTEICGAPGVGKTQLW |
RAD51C (Homo sapiens) is able to recognize following damages:
RAD51C (Homo sapiens) belongs to following protein families:
References:
| Title | Authors | Journal |
| Isolation and characterization of RAD51C, a new human member of the RAD51 family of related genes. | Dosanjh MK, Collins DW, Fan W, Lennon GG, Albala JS, Shen Z, Schild D | Nucleic Acids Res March 1, 1998 |
| Identification and purification of two distinct complexes containing the five RAD51 paralogs. | Masson JY, Tarsounas MC, Stasiak AZ, Stasiak A, Shah R, McIlwraith MJ, Benson FE, West SC | Genes Dev Dec. 15, 2001 |
| Mediator function of the human Rad51B-Rad51C complex in Rad51/RPA-catalyzed DNA strand exchange. | Sigurdsson S, Van Komen S, Bussen W, Schild D, Albala JS, Sung P | Genes Dev Dec. 15, 2001 |
| Involvement of Rad51C in two distinct protein complexes of Rad51 paralogs in human cells. | Liu N, Schild D, Thelen MP, Thompson LH | Nucleic Acids Res Jan. 15, 2002 |
| Interactions involving the Rad51 paralogs Rad51C and XRCC3 in human cells. | Wiese C, Collins DW, Albala JS, Thompson LH, Kronenberg A, Schild D | Nucleic Acids Res Jan. 15, 2002 |
| RAD51C interacts with RAD51B and is central to a larger protein complex in vivo exclusive of RAD51. | Miller KA, Yoshikawa DM, McConnell IR, Clark R, Schild D, Albala JS | J Biol Chem March 8, 2002 |
| Complex formation by the human Rad51B and Rad51C DNA repair proteins and their activities in vitro. | Lio YC, Mazin AV, Kowalczykowski SC, Chen DJ | J Biol Chem Feb. 24, 2003 |
| The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). | Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J | Genome Res Oct. 1, 2004 |
Last modification of this entry: Oct. 11, 2010.
Add your own comment!
There is no comment yet.
|
|
|
|